Recombinant Human SCGF beta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCGF beta Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 214-323 of Human CLEC11A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLEC11A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCGF beta Protein

  • CLECSF3C-type lectin superfamily member 3
  • C-type lectin domain family 11 member A
  • C-type lectin domain family 11, member A
  • LSLCLC-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 3
  • Lymphocyte secreted C-type lectin
  • lymphocyte secreted long form of C-type lectin
  • P47
  • SCGF
  • Stem cell growth factor
  • stem cell growth factor; lymphocyte secreted C-type lectin

Background

CLEC11A - C-type lectin domain family 11, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SCGF beta Partial Recombinant Protein (H00006320-Q01) (0)

There are no publications for SCGF beta Partial Recombinant Protein (H00006320-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCGF beta Partial Recombinant Protein (H00006320-Q01) (0)

There are no reviews for SCGF beta Partial Recombinant Protein (H00006320-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCGF beta Partial Recombinant Protein (H00006320-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCGF beta Products

Bioinformatics Tool for SCGF beta Partial Recombinant Protein (H00006320-Q01)

Discover related pathways, diseases and genes to SCGF beta Partial Recombinant Protein (H00006320-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCGF beta Partial Recombinant Protein (H00006320-Q01)

Discover more about diseases related to SCGF beta Partial Recombinant Protein (H00006320-Q01).
 

Pathways for SCGF beta Partial Recombinant Protein (H00006320-Q01)

View related products by pathway.

Blogs on SCGF beta

There are no specific blogs for SCGF beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCGF beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC11A