SCGB1D4 Antibody

Images

 
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - skin
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Immunohistochemical staining of human esophagus shows moderate cytoplasmic and nucleolar positivity in squamous epithelial cells.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - skin
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - liver cancer
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Immunohistochemical staining of human esophagus shows moderate cytoplasmic and nucleolar positivity in squamous epithelial cells.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - liver cancer

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

SCGB1D4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQISFKKRLSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
SCGB1D4 Protein (NBP2-32549PEP)

Alternate Names for SCGB1D4 Antibody

  • IFN-Gamma Inducible SCGB (IIS)
  • IFN-Gamma-Inducible Secretoglobin
  • IIS
  • Secretoglobin Family 1D Member 4
  • Secretoglobin, Family 1D, Member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3465
Species: Mu
Applications: WB
AF2790
Species: Hu
Applications: WB
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P
MAB814R
Species: Hu
Applications: Neut
NBP1-86008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81304
Species: Hu
Applications: IHC, IHC-P
MAB4867R
Species: Hu
Applications: Flow
NBP1-92604
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64387
Species: Mu
Applications: B/N, ELISA, Func, IHC, IHC-Fr
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
NBP2-43615
Species: Hu
Applications: WB
NB100-56472
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32549
Species: Hu
Applications: IHC, IHC-P

Publications for SCGB1D4 Antibody (NBP2-32549) (0)

There are no publications for SCGB1D4 Antibody (NBP2-32549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCGB1D4 Antibody (NBP2-32549) (0)

There are no reviews for SCGB1D4 Antibody (NBP2-32549). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCGB1D4 Antibody (NBP2-32549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCGB1D4 Antibody Products

SCGB1D4 NBP2-32549

Related Products by Gene

Diseases for SCGB1D4 Antibody (NBP2-32549)

Discover more about diseases related to SCGB1D4 Antibody (NBP2-32549).
 

Pathways for SCGB1D4 Antibody (NBP2-32549)

View related products by pathway.

Blogs on SCGB1D4

There are no specific blogs for SCGB1D4, but you can read our latest blog posts.

Contact Information

Product PDFs

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32549 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought