SCGB1D4 Antibody


Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Staining of skin.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Staining of human esophagus shows moderate cytoplasmic and nucleolar positivity in squamous epithelial cells.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Staining of skin.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Staining of liver cancer.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Staining of human esophagus shows moderate cytoplasmic and nucleolar positivity in squamous epithelial cells.
Immunohistochemistry: SCGB1D4 Antibody [NBP2-32549] - Staining of liver cancer.

Product Details

Product Discontinued
View other related SCGB1D4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SCGB1D4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQISFKKRLSL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SCGB1D4 Antibody

  • IFN-Gamma Inducible SCGB (IIS)
  • IFN-Gamma-Inducible Secretoglobin
  • IIS
  • Secretoglobin Family 1D Member 4
  • Secretoglobin, Family 1D, Member 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: B/N, ELISA, Func, IHC, IHC-Fr
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for SCGB1D4 Antibody (NBP2-32549) (0)

There are no publications for SCGB1D4 Antibody (NBP2-32549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCGB1D4 Antibody (NBP2-32549) (0)

There are no reviews for SCGB1D4 Antibody (NBP2-32549). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCGB1D4 Antibody (NBP2-32549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Related Products by Gene

Diseases for SCGB1D4 Antibody (NBP2-32549)

Discover more about diseases related to SCGB1D4 Antibody (NBP2-32549).

Pathways for SCGB1D4 Antibody (NBP2-32549)

View related products by pathway.

Blogs on SCGB1D4

There are no specific blogs for SCGB1D4, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SCGB1D4 Antibody and receive a gift card or discount.