SCF/c-kit Ligand Antibody (2H8)

Images

 

Product Details

Summary
Product Discontinued
View other related SCF/c-kit Ligand Primary Antibodies

Order Details


    • Catalog Number
      H00004254-M10
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SCF/c-kit Ligand Antibody (2H8) Summary

Immunogen
KITLG (NP_003985, 26 a.a. - 245 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
Specificity
KITLG (2H8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KITLG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity Against Recombinant Protein with GST tag on ELISA. GST tag alone is used as a negative control. It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCF/c-kit Ligand Antibody (2H8)

  • c-kit Ligand
  • DKFZp686F2250
  • familial progressive hyperpigmentation 2
  • FPH2
  • KIT ligand
  • Kitl
  • KITLG
  • KL-1
  • Mast cell growth factor
  • MGF
  • MGFSHEP7
  • SCF
  • SCFStem cell factor
  • SFc-Kit ligand
  • SLF
  • steel factor

Background

This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA

Publications for SCF/c-kit Ligand Antibody (H00004254-M10) (0)

There are no publications for SCF/c-kit Ligand Antibody (H00004254-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCF/c-kit Ligand Antibody (H00004254-M10) (0)

There are no reviews for SCF/c-kit Ligand Antibody (H00004254-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCF/c-kit Ligand Antibody (H00004254-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCF/c-kit Ligand Products

Bioinformatics Tool for SCF/c-kit Ligand Antibody (H00004254-M10)

Discover related pathways, diseases and genes to SCF/c-kit Ligand Antibody (H00004254-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCF/c-kit Ligand Antibody (H00004254-M10)

Discover more about diseases related to SCF/c-kit Ligand Antibody (H00004254-M10).
 

Pathways for SCF/c-kit Ligand Antibody (H00004254-M10)

View related products by pathway.

PTMs for SCF/c-kit Ligand Antibody (H00004254-M10)

Learn more about PTMs related to SCF/c-kit Ligand Antibody (H00004254-M10).
 

Research Areas for SCF/c-kit Ligand Antibody (H00004254-M10)

Find related products by research area.

Blogs on SCF/c-kit Ligand

There are no specific blogs for SCF/c-kit Ligand, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCF/c-kit Ligand Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol KITLG
Entrez
OMIM
Uniprot