SCAMP1 Antibody

Images

 
Western Blot: SCAMP1 Antibody [NBP1-69193] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

Product Details

Summary
Product Discontinued
View other related SCAMP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69193
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SCAMP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SCAMP1 (secretory carrier membrane protein 1) The peptide sequence was selected from the middle region of SCAMP1. Peptide sequence LDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK.
Clonality
Polyclonal
Host
Rabbit
Gene
SCAMP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SCAMP1 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SCAMP1 Antibody

  • secretory carrier membrane protein 1SCAMP37SCAMP
  • secretory carrier-associated membrane protein 1

Background

This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45688
Species: Hu
Applications: WB, IHC
AF5344
Species: Hu, Mu
Applications: WB
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP2-04611
Species: Hu
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13284
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13347
Species: Hu
Applications: WB, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-69193
Species: Hu, Rt
Applications: WB

Publications for SCAMP1 Antibody (NBP1-69193) (0)

There are no publications for SCAMP1 Antibody (NBP1-69193).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP1 Antibody (NBP1-69193) (0)

There are no reviews for SCAMP1 Antibody (NBP1-69193). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCAMP1 Antibody (NBP1-69193) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCAMP1 Products

Bioinformatics Tool for SCAMP1 Antibody (NBP1-69193)

Discover related pathways, diseases and genes to SCAMP1 Antibody (NBP1-69193). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP1 Antibody (NBP1-69193)

Discover more about diseases related to SCAMP1 Antibody (NBP1-69193).
 

Pathways for SCAMP1 Antibody (NBP1-69193)

View related products by pathway.

PTMs for SCAMP1 Antibody (NBP1-69193)

Learn more about PTMs related to SCAMP1 Antibody (NBP1-69193).
 

Research Areas for SCAMP1 Antibody (NBP1-69193)

Find related products by research area.

Blogs on SCAMP1

There are no specific blogs for SCAMP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCAMP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAMP1
Uniprot