Recombinant SARS-CoV-2 Spike S1 (Fc Chimera) Protein

Images

 
SDS-Page: Recombinant Virus SARS-CoV-2 Spike S1 Fc Chimera Protein [NBP2-90983] - Recombinant 2019-nCoV Spike S1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 130-160 kDa.
ELISA: Recombinant Virus SARS-CoV-2 Spike S1 Fc Chimera Protein [NBP2-90983] - Measured by its binding ability in a functional ELISA. Immobilized nCoV-S1 at 2 g/mL (100 L/well) can bind Recombinant Human ACE2 with a ...read more

Product Details

Summary
Applications ELISA, PAGE
Concentration
LYOPH

Order Details

Recombinant SARS-CoV-2 Spike S1 (Fc Chimera) Protein Summary

Description
A bioactive partial recombinant protein fused with a human Fc region and a His tag at the C-terminal and corresponding to the amino acids sequence of (11-682) of the SARS-CoV-2 Spike S1

Source: HEK293

VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (Accession #YP_009724390.1)

Details of Functionality
Measured by its binding ability in a functional ELISA. Immobilized nCoV-S1 at 2 g/mL (100 L/well) can bind Recombinant Human ACE2 with a linear range of 0.06-0.3ug/mL.
Source
HEK293
Protein/Peptide Type
Recombinant Protein
Purity
>92%, by SDS-PAGE
Endotoxin Note
< 0.1 EU/ug of the protein by LAL method.

Packaging, Storage & Formulations

Storage
Store at -20 to -70C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Preservative
No Preservative
Concentration
LYOPH
Purity
>92%, by SDS-PAGE
Reconstitution Instructions
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.

Background

Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). Seven coronaviruses had been found to cause human infection including SARS-CoV-2/2019-nCoV resulting in a potentially fatal atypical pneumonia, named COVID-19. SARS-CoV-2 has 4 major structural proteins including spike (S), envelope (E), membrane (M), and nucleocapsid (N), which share significant sequence homology with SARS-CoV. The spike protein in SARS-CoV-2 (1,273 aa) is a viral surface glycoprotein. Research on SARS-host protein interactions with SARS-CoV and SARS-CoV-2 viruses have shown that the viral spike (S) protein binds human ACE-2 located on the surface of mucosal cells, resulting in fusion of viral and cell membranes for viral entry. Viral entry also requires priming of the S protein by host cell proteases such as TMPRSS2, Cathepsin L or furin. The Coronavirus Spike precursor protein is processed into 2 distinct subunits with S1 (654 aa) housing the receptor binding domain (RBD) and S2 (588 aa or 458 a) facilitating membrane fusion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for SARS-CoV-2 Spike S1 Recombinant Protein (NBP2-90983) (0)

There are no publications for SARS-CoV-2 Spike S1 Recombinant Protein (NBP2-90983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 Spike S1 Recombinant Protein (NBP2-90983) (0)

There are no reviews for SARS-CoV-2 Spike S1 Recombinant Protein (NBP2-90983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SARS-CoV-2 Spike S1 Recombinant Protein (NBP2-90983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SARS-CoV-2 Spike S1 Products

Array NBP2-90983

Blogs on SARS-CoV-2 Spike S1

There are no specific blogs for SARS-CoV-2 Spike S1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant SARS-CoV-2 Spike S1 (Fc Chimera) Protein and receive a gift card or discount.