Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein

ELISA: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986] - Immobilized Recombinant SARS-CoV-2 Envelope at 2ug/mL (100 uL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.

SDS-Page: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986] - Recombinant SARS-CoV-2 Envelope Protein with His and Avi tag was determined by SDS-PAGE with Coomassie Blue, showing a band at 12 kDa.

• Applications: ELISA, PAGE

Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein Summary

• Description: A full length recombinant protein with a N-Terminal His-tag and Avi epitope tag and corresponding to the amino acids sequence of (1-75) of the SARS-CoV-2 envelope protein
  
  

  Source: E.coli

  
  MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV (Accession #YP_009724392.1)

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: E
• Purity: >95%, by SDS-PAGE
• Endotoxin Note: < 0.1 EU/ug of the protein by LAL method.

Applications/Dilutions

• Dilutions:
  • ELISA
  • SDS-Page
• Application Notes: Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Envelope at 2ug/mL (100 uL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.
• Theoretical MW: 11.4 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20 to -70C. Avoid freeze-thaw cycles.
• Buffer: Supplied as a 0.22 um filtered solution in 20mM Tris, 250mM NaCl, 0.5%TritonX-100, pH 8.0.
• Preservative: No Preservative
• Purity: >95%, by SDS-PAGE

Alternate Names for Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein

• 2019-nCoV Envelope protein
• COVID-19 Envelope protein
• E Protein
• Envelope
• Human Coronavirus Envelope protein
• SARS-CoV-2 E protein
• SARSCoV2 Envelope protein
• SARS-CoV-2 Envelope protein
• SARSCoV2
• Severe acute respiratory syndrome 2 Envelope Protein

Background

The SARS-CoV-2 Envelope protein is one of the four major structural proteins of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). The envelope protein is the smallest of the four structural proteins, which also includes the membrane protein, spike protein, and nucleocapsid protein (1,2). The envelope protein is synthesized as a 75 amino acid protein with a theoretical molecular weight of approximately 8.4 kDa (2,3). Furthermore, the envelope protein of SARS-CoV-2 has 94.7% sequence identity and 97.4% sequence similarity to the envelope protein of SARS-CoV (2). Structurally, the envelope protein is a membrane protein with a N-terminal domain, an alpha-helical transmembrane domain, and a hydrophilic C-terminal domain (1,4). The envelope protein has multiple functions in viral replication including viral assembly, release, and pathogenesis (2,4). Additionally, the SARS-CoV-2 envelope protein has ion channel activity and functions as a viroporin with a role in virion trafficking (2,4). Coronaviruses lacking the envelope protein are shown to have reduced viral titer and slowed or defective maturation, indicative of a role in virus production and growth (4).

References

1. Malik Y. A. (2020). Properties of Coronavirus and SARS-CoV-2. The Malaysian Journal of Pathology.

2. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4

3. Uniprot (P0DTC4)

4. J Alsaadi, E. A., & Jones, I. M. (2019). Membrane binding proteins of coronaviruses. Future Virology. https://doi.org/10.2217/fvl-2018-0144

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for SARS-CoV-2 Envelope Recombinant Protein (NBP2-90986)(3)

Publications using NBP2-90986

• Guo L, Chen Q, Xu M et Al. Communication between alveolar macrophages and fibroblasts via the TNFSF12-TNFRSF12A pathway promotes pulmonary fibrosis in severe COVID-19 patients J Transl Med 2024-07-30 [PMID: 39075394]
• Lin ZH, Yeh H, Lo HC et al. GMI, a fungal immunomodulatory protein, ameliorates SARS-CoV-2 envelope protein-induced inflammation in macrophages via inhibition of MAPK pathway International journal of biological macromolecules 2023-04-27 [PMID: 37119883]
• Barnett KC, Xie Y, Asakura T et al. An epithelial-immune circuit amplifies inflammasome and IL-6 responses to SARS-CoV-2 Cell host & microbe 2022-12-09 [PMID: 36563691] (Biacore Binding Assay)

Bioinformatics

• Gene Symbol: E