Recombinant Human SAP30 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SAP30 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 131-219 of Human SAP30 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SAP30
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SAP30 Protein

  • 30 kDa Sin3-associated polypeptide
  • histone deacetylase complex subunit SAP30
  • Sin3 corepressor complex subunit SAP30
  • Sin3A-associated protein, 30kDa
  • Sin3-associated polypeptide p30
  • sin3-associated polypeptide, 30 kDa
  • Sin3-associated polypeptide, 30kDa

Background

SAP30 - sin3-associated polypeptide, 30kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-26616
Species: Hu
Applications: WB, IP
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-38685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB100-491
Species: Hu
Applications: WB
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NB600-1263
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82598
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61159
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89385
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009541-M01
Species: Hu
Applications: WB, ELISA
NB100-257
Species: Hu, Mu
Applications: WB, PLA
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
H00008819-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SAP30 Partial Recombinant Protein (H00008819-Q01) (0)

There are no publications for SAP30 Partial Recombinant Protein (H00008819-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP30 Partial Recombinant Protein (H00008819-Q01) (0)

There are no reviews for SAP30 Partial Recombinant Protein (H00008819-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAP30 Partial Recombinant Protein (H00008819-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAP30 Products

Bioinformatics Tool for SAP30 Partial Recombinant Protein (H00008819-Q01)

Discover related pathways, diseases and genes to SAP30 Partial Recombinant Protein (H00008819-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP30 Partial Recombinant Protein (H00008819-Q01)

Discover more about diseases related to SAP30 Partial Recombinant Protein (H00008819-Q01).
 

Pathways for SAP30 Partial Recombinant Protein (H00008819-Q01)

View related products by pathway.

PTMs for SAP30 Partial Recombinant Protein (H00008819-Q01)

Learn more about PTMs related to SAP30 Partial Recombinant Protein (H00008819-Q01).

Blogs on SAP30

There are no specific blogs for SAP30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HDAC1 Antibody
NB100-56340
SAP30 Antibody (4D2)
H00008819-M02
HDAC3 Antibody
NB100-1669

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SAP30 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SAP30