SAP30 Antibody (4D2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related SAP30 Primary Antibodies

Order Details


    • Catalog Number
      H00008819-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SAP30 Antibody (4D2) [DyLight 488] Summary

Immunogen
SAP30 (NP_003855, 131 a.a. - 219 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV
Specificity
SAP30 (4D2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SAP30
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SAP30 Antibody (4D2) [DyLight 488]

  • 30 kDa Sin3-associated polypeptide
  • histone deacetylase complex subunit SAP30
  • Sin3 corepressor complex subunit SAP30
  • Sin3A-associated protein, 30kDa
  • Sin3-associated polypeptide p30
  • sin3-associated polypeptide, 30 kDa
  • Sin3-associated polypeptide, 30kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-14085
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-26616
Species: Hu
Applications: WB, IP
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-38685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB100-491
Species: Hu
Applications: WB
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NB600-1263
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82598
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61159
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89385
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009541-M01
Species: Hu
Applications: WB, ELISA
NB100-257
Species: Hu, Mu
Applications: WB, PLA
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
H00008819-M02G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SAP30 Antibody (H00008819-M02G) (0)

There are no publications for SAP30 Antibody (H00008819-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP30 Antibody (H00008819-M02G) (0)

There are no reviews for SAP30 Antibody (H00008819-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SAP30 Antibody (H00008819-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAP30 Products

Bioinformatics Tool for SAP30 Antibody (H00008819-M02G)

Discover related pathways, diseases and genes to SAP30 Antibody (H00008819-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP30 Antibody (H00008819-M02G)

Discover more about diseases related to SAP30 Antibody (H00008819-M02G).
 

Pathways for SAP30 Antibody (H00008819-M02G)

View related products by pathway.

PTMs for SAP30 Antibody (H00008819-M02G)

Learn more about PTMs related to SAP30 Antibody (H00008819-M02G).

Blogs on SAP30

There are no specific blogs for SAP30, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP30 Antibody (4D2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol SAP30