SAP130 Antibody

Images

 
Western Blot: SAP130 Antibody [NBP1-57144] - HCT15 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related SAP130 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57144
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SAP130 Antibody Summary

Immunogen
Synthetic peptides corresponding to SF3B3 (splicing factor 3b, subunit 3, 130kDa) The peptide sequence was selected from the middle region of SF3B3)(50ug). Peptide sequence TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI.
Specificity
This product is specific to Subunit or Isoform: 3.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SF3B3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SF3B3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SAP130 Antibody

  • KIAA0017splicing factor 3b, subunit 3, 130kD
  • Pre-mRNA-splicing factor SF3b 130 kDa subunit
  • RSE1
  • SAP130SAP 130
  • SF3B130
  • SF3b130pre-mRNA splicing factor SF3b, 130 kDa subunit
  • Spliceosome-associated protein 130
  • splicing factor 3B subunit 3
  • splicing factor 3b, subunit 3, 130kDa
  • STAF130

Background

SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-92692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66163
Species: Hu
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
AF3297
Species: Hu
Applications: WB
NBP2-49303
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-56629
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-47427
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-49311
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for SAP130 Antibody (NBP1-57144) (0)

There are no publications for SAP130 Antibody (NBP1-57144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP130 Antibody (NBP1-57144) (0)

There are no reviews for SAP130 Antibody (NBP1-57144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAP130 Antibody (NBP1-57144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SAP130 Products

Bioinformatics Tool for SAP130 Antibody (NBP1-57144)

Discover related pathways, diseases and genes to SAP130 Antibody (NBP1-57144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP130 Antibody (NBP1-57144)

Discover more about diseases related to SAP130 Antibody (NBP1-57144).
 

Pathways for SAP130 Antibody (NBP1-57144)

View related products by pathway.

PTMs for SAP130 Antibody (NBP1-57144)

Learn more about PTMs related to SAP130 Antibody (NBP1-57144).

Blogs on SAP130

There are no specific blogs for SAP130, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP130 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3B3
Uniprot