SAMD9L Antibody


Western Blot: SAMD9L Antibody [NBP2-88209] - Host: Rabbit. Target Name: SAMD9L. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SAMD9L Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMD9L. Peptide sequence: LIKRSYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMS The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for SAMD9L Antibody

  • DRIF2
  • FLJ39885
  • KIAA2005
  • sterile alpha motif domain containing 9-like
  • UEF
  • UEF1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SAMD9L Antibody (NBP2-88209) (0)

There are no publications for SAMD9L Antibody (NBP2-88209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD9L Antibody (NBP2-88209) (0)

There are no reviews for SAMD9L Antibody (NBP2-88209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAMD9L Antibody (NBP2-88209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SAMD9L Products

Bioinformatics Tool for SAMD9L Antibody (NBP2-88209)

Discover related pathways, diseases and genes to SAMD9L Antibody (NBP2-88209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMD9L Antibody (NBP2-88209)

Discover more about diseases related to SAMD9L Antibody (NBP2-88209).

Pathways for SAMD9L Antibody (NBP2-88209)

View related products by pathway.

Blogs on SAMD9L

There are no specific blogs for SAMD9L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SAMD9L Antibody and receive a gift card or discount.


Gene Symbol SAMD9L