Home » SAMD9L » SAMD9L Research Products » SAMD9L Antibody

SAMD9L Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SAMD9L Antibody [NBP2-88209] - Host: Rabbit. Target Name: SAMD9L. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: SAMD9L Antibody [NBP2-88209] - Host: Rabbit. Target Name: SAMD9L. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SAMD9L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMD9L. Peptide sequence: LIKRSYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SAMD9L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAMD9L Antibody

  • DRIF2
  • FLJ39885
  • KIAA2005
  • sterile alpha motif domain containing 9-like
  • UEF
  • UEF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SAMD9 Antibody
NBP1-91244
Western Blot: SAMD9 Antibody [NBP1-91244] - Analysis in human cell lines A-431 and MCF-7 using anti-SAMD9 antibody. Corresponding SAMD9 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Immunocytochemistry/Immunofluorescence: SAMD9 Antibody [NBP1-91244] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: SAMD9 Antibody [NBP1-91244] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
USF1 Antibody
NBP2-38290
Western Blot: USF1 Antibody [NBP2-38290] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: USF1 Antibody [NBP2-38290] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: USF1 Antibody [NBP2-38290] - Staining of human tonsil shows strong nuclear positivity.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
u-Plasminogen Activator/Urokinase [Unconjugated]
(8 Publications)
Species: Hu
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
MARCKS like
protein Antibody (8C8
H00065108-M02
Western Blot: MARCKS like protein Antibody (8C8) [H00065108-M02] - Analysis of MARCKSL1 expression in transfected 293T cell line by MARCKSL1 monoclonal antibody (M02), clone 8C8.Lane 1: MARCKSL1 transfected lysate(19.398 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: MARCKS like protein Antibody (8C8) [H00065108-M02] - Analysis of monoclonal antibody to MARCKSL1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: MARCKS like protein Antibody (8C8) [H00065108-M02] - Detection limit for recombinant GST tagged MARCKSL1 is approximately 0.1ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MUC2 Antibody
(996/1)
NB120-11197
Immunohistochemistry: MUC2 Antibody (996/1) [NB120-11197] - Immunofluorescence of Mucin 2 (Muc2; mucous-forming protein) (F-J) in proximal colon in all experimental groups. Histological scores were highest in MS, demonstrated injury in MS compared to control. Treatment with Antalarmin and Astressin prevented this MS-induced colonic injury, but not by Astressin-2B. Image collected and cropped by CiteAb from the following publication (nature.com/articles/srep46616), licensed under a CC-BY licence.
Immunohistochemistry: MUC2 Antibody (996/1) [NB120-11197] - Maternal LB modulates IL-1B-induced goblet cell Tff3 and MUC2 response to inflammatory stress in pre-weaned mice. a,b) Immunofluorescence detection of MUC2 molecules (red) in the mouse goblet cells in SPF (a) vs SPF/LB pups (b). Representative areas (n = 3 per group) are shown Bar 100 uM, magnification 400x. c,d) Representative areas of MUC2 exclusion from goblet cells in response to IL-1B stimulation in SPF (c) or SPF/LB (d) pups are shown; magnification 400x. Image collected and cropped by CiteAb from the following publication (https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0237182), licensed under a CC-BY licence.
Flow Cytometry: MUC2 Antibody (996/1) [NB120-11197] - An intracellular stain was performed on HeLa cells with MUC2 Antibody [996/1] NB120-11197AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Pea3 Antibody
NBP1-87960
Immunocytochemistry/Immunofluorescence: Pea3 Antibody [NBP1-87960] - Staining of human cell line U-251 MG shows localization to nucleoli. Antibody staining is shown in green. Antibody staining is shown in green.
Immunohistochemistry-Frozen: Pea3 Antibody [NBP1-87960] - Pea3 staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1:40. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
DNASE1 Antibody
NBP1-84999
Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IFN-alpha 1 Antibody [NBP2-75930] - analysis of paraffin-embedded mouse brain tissue tissue using anti-IFNA1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Human PTH ELISA
Kit (Colorimetric)
NBP2-60629
ELISA: Human PTH ELISA Kit (Colorimetric) [NBP2-60629]
(1 Publication)
Species: Hu
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
FosB/G0S3 Antibody
(83B1138)
NB100-56530
Western Blot: FosB/G0S3 Antibody (83B1138) [NB100-56530] - Analysis of FosB in HeLa cell lysate where bands are observed at ~38 kDa representing FosB and at ~35 kDa representing delta FosB.
Species: Hu
Applications: WB
OCT1 Antibody
NBP2-21584
Western Blot: OCT1 Antibody [NBP2-21584] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with OCT1 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: OCT1 Antibody [NBP2-21584] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: OCT1 protein stained by OCT1 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, stained by () diluted at 1:200. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: OCT1 Antibody [NBP2-21584] - Rat brain. OCT1 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
YB1 Antibody
NBP1-97572
Knockdown Validated: YB1 Antibody [NBP1-97572] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:10000 ug/ml of Rabbit Anti-Human YB-1 Polyclonal Antibody (Catalog # NBP1-97572) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for YB-1 at approximately 49 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: YB1 Antibody [NBP1-97572] - Western blot analysis of YB1 expression in 1) HeLa and 2) NTera2 whole cell lysates using NBP1-97572.
Immunocytochemistry/Immunofluorescence: YB1 Antibody [NBP1-97572] - The YB1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin (NB100-690) were counterstained with DAPI (blue) and Dylight 550 (red).
(3 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L Antibody [Unconjugated]
(4 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
RREB1 Antibody
NBP1-03020
Immunohistochemistry-Paraffin: RREB1 Antibody [NBP1-03020] - Staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Analysis of paraffin-embedded mouse testis tissue using anti-Phospho-JunD(S255) antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
JunB/AP-1 Antibody
NBP1-89544
Western Blot: JunB/AP-1 Antibody [NBP1-89544] - Analysis in human cell lines MCF-7 and HEK293 using anti-JUNB antibody. Corresponding JUNB RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining in human fallopian tube and skeletal muscle tissues. Corresponding JUNB RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SAMD9L Antibody
NBP2-88209
SAMD9L Antibody
Species: Hu
Applications: WB

Publications for SAMD9L Antibody (NBP2-88209) (0)

There are no publications for SAMD9L Antibody (NBP2-88209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD9L Antibody (NBP2-88209) (0)

There are no reviews for SAMD9L Antibody (NBP2-88209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAMD9L Antibody (NBP2-88209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SAMD9L Products

Bioinformatics Tool for SAMD9L Antibody (NBP2-88209)

Discover related pathways, diseases and genes to SAMD9L Antibody (NBP2-88209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAMD9L Antibody (NBP2-88209)

Discover more about diseases related to SAMD9L Antibody (NBP2-88209).
 

Pathways for SAMD9L Antibody (NBP2-88209)

View related products by pathway.

Blogs on SAMD9L

There are no specific blogs for SAMD9L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAMD9L Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SAMD9L