SAM68 Antibody

Product Discontinued

SAM68 Antibody Summary

• Immunogen: Synthetic peptides corresponding to KHDRBS1(KH domain containing, RNA binding, signal transduction associated 1) The peptide sequence was selected from the N terminal of KHDRBS1. Peptide sequence LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYL
• Predicted Species: Mouse (93%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KHDRBS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against KHDRBS1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SAM68 Antibody

• FLJ34027
• GAP-associated tyrosine phosphoprotein p62
• KH domain containing, RNA binding, signal transduction associated 1
• KH domain-containing, RNA-binding, signal transduction-associated protein 1
• KHDRBS1
• p21 Ras GTPase-activating protein-associated p62
• p62
• p68
• SAM68
• Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68)
• Src-associated in mitosis 68 kDa protein

Background

KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KHDRBS1
• Uniprot:
  • Q07666()