SALL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SALL1 Antibody [NBP3-17307] - Staining of human cell line BJ shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SALL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SALL1 Antibody - BSA Free (NBP3-17307) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGLSPTPVNGGALDLTSSHAEK
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SALL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SALL1 Antibody - BSA Free

• HSAL1
• sal (Drosophila)-like 1
• SAL1
• Sal-1
• SALL1
• sal-like 1 (Drosophila)
• sal-like protein 1
• Spalt-like transcription factor 1
• Zinc finger protein 794
• Zinc finger protein SALL1
• Zinc finger protein Spalt-1
• ZNF794TBS

Background

The protein encoded by the SALL1 gene is a zinc finger transcriptional repressor and may be part of the NuRD histone deacetylase complex (HDAC). Defects in this gene are a cause of Townes-Brocks syndrome (TBS) as well as bronchio-oto-renal syndrome (BOR). Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SALL1