S1P5/EDG-8 Antibody

Product Discontinued

S1P5/EDG-8 Antibody Summary

• Immunogen: Synthetic peptides corresponding to EDG8(endothelial differentiation, sphingolipid G-protein-coupled receptor, 8) The peptide sequence was selected from the N terminal of EDG8. Peptide sequence MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLA
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Canine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S1PR5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 2.5 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against EDG8 and was validated on Western Blot and immunohistochemistry-paraffin
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for S1P5/EDG-8 Antibody

• EDG8
• Edg-8
• EDG8S1P receptor Edg-8
• Endothelial differentiation G-protein-coupled receptor 8
• endothelial differentiation, sphingolipid G-protein-coupled receptor, 8
• LPB4
• S1P receptor 5
• S1P5
• S1PR5
• sphingosine 1-phosphate receptor 5
• sphingosine 1-phosphate receptor EDG8
• Sphingosine 1-phosphate receptor Edg-8
• sphingosine-1-phosphate receptor 5
• SPPR-1
• SPPR-2

Background

EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: S1PR5