S1P3/EDG-3 Antibody (2G11)

Images

 
Immunohistochemistry-Paraffin: S1P3/EDG-3 Antibody (2G11) [H00001903-M02] - Analysis of monoclonal antibody to S1PR3 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Sandwich ELISA: S1P3/EDG-3 Antibody (2G11) [H00001903-M02] - Detection limit for recombinant GST tagged S1PR3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
2G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S1P3/EDG-3 Antibody (2G11) Summary

Immunogen
EDG3 (NP_005217.2 302 a.a. - 378 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
Specificity
EDG3 - endothelial differentiation, sphingolipid G-protein-coupled receptor, 3 (2G11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S1PR3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S1P3/EDG-3 Antibody (2G11)

  • EDG3
  • EDG-3
  • EDG3FLJ37523
  • Endothelial differentiation G-protein coupled receptor 3
  • endothelial differentiation, sphingolipid G-protein-coupled receptor, 3
  • FLJ93220
  • G protein-coupled receptor, endothelial differentiation gene-3
  • LPB3
  • MGC71696
  • S1P receptor 3
  • S1P receptor EDG3
  • S1P receptor Edg-3
  • S1P3
  • S1PR3
  • sphingosine 1-phosphate receptor 3
  • Sphingosine 1-phosphate receptor Edg-3
  • sphingosine-1-phosphate receptor 3

Background

This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24712
Species: Hu, Mu, Rt, Ca, Pm, Xp
Applications: WB, IHC-P
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-03363
Species: Hu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-24500
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NLS1014
Species: Hu, Mu, Rt, Bt, Bv, Ca, Eq, Ha, Mk, Pm
Applications: IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
H00001903-M02
Species: Hu
Applications: ELISA, IHC-P

Publications for S1P3/EDG-3 Antibody (H00001903-M02) (0)

There are no publications for S1P3/EDG-3 Antibody (H00001903-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S1P3/EDG-3 Antibody (H00001903-M02) (0)

There are no reviews for S1P3/EDG-3 Antibody (H00001903-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for S1P3/EDG-3 Antibody (H00001903-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S1P3/EDG-3 Products

Bioinformatics Tool for S1P3/EDG-3 Antibody (H00001903-M02)

Discover related pathways, diseases and genes to S1P3/EDG-3 Antibody (H00001903-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S1P3/EDG-3 Antibody (H00001903-M02)

Discover more about diseases related to S1P3/EDG-3 Antibody (H00001903-M02).
 

Pathways for S1P3/EDG-3 Antibody (H00001903-M02)

View related products by pathway.

PTMs for S1P3/EDG-3 Antibody (H00001903-M02)

Learn more about PTMs related to S1P3/EDG-3 Antibody (H00001903-M02).
 

Research Areas for S1P3/EDG-3 Antibody (H00001903-M02)

Find related products by research area.

Blogs on S1P3/EDG-3

There are no specific blogs for S1P3/EDG-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S1P3/EDG-3 Antibody (2G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol S1PR3
Entrez
Uniprot