S1P1/EDG-1 Antibody

Images

 
Western Blot: S1P1/EDG-1 Antibody [H00001901-D01P] - Analysis of EDG1 expression in mouse lung.
Western Blot: S1P1/EDG-1 Antibody [H00001901-D01P] - Analysis of S1PR1 expression in transfected 293T cell line by S1PR1 polyclonal antibody.Lane 1: EDG1 transfected lysate(42.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

S1P1/EDG-1 Antibody Summary

Immunogen
EDG1 (NP_001391.2, 1 a.a. - 382 a.a.) full-length human protein. MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Specificity
EDG1 - endothelial differentiation, sphingolipid G-protein-coupled receptor, 1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S1PR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S1P1/EDG-1 Antibody

  • CD363 antigen
  • CD363
  • CHEDG1
  • D1S3362
  • EDG1
  • EDG-1
  • EDG1edg-1
  • Endothelial differentiation G-protein coupled receptor 1
  • endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
  • FLJ58121
  • S1P receptor 1
  • S1P receptor Edg-1
  • S1P1
  • S1P1ECGF1
  • S1PR1
  • sphingosine 1-phosphate receptor 1
  • sphingosine 1-phosphate receptor EDG1
  • Sphingosine 1-phosphate receptor Edg-1
  • sphingosine-1-phosphate receptor 1

Background

The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24712
Species: Hu, Mu, Rt, Ca, Pm, Xp
Applications: WB, IHC-P
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-03363
Species: Hu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24500
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu

Publications for S1P1/EDG-1 Antibody (H00001901-D01P) (0)

There are no publications for S1P1/EDG-1 Antibody (H00001901-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S1P1/EDG-1 Antibody (H00001901-D01P) (0)

There are no reviews for S1P1/EDG-1 Antibody (H00001901-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S1P1/EDG-1 Antibody (H00001901-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S1P1/EDG-1 Products

Bioinformatics Tool for S1P1/EDG-1 Antibody (H00001901-D01P)

Discover related pathways, diseases and genes to S1P1/EDG-1 Antibody (H00001901-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S1P1/EDG-1 Antibody (H00001901-D01P)

Discover more about diseases related to S1P1/EDG-1 Antibody (H00001901-D01P).
 

Pathways for S1P1/EDG-1 Antibody (H00001901-D01P)

View related products by pathway.

PTMs for S1P1/EDG-1 Antibody (H00001901-D01P)

Learn more about PTMs related to S1P1/EDG-1 Antibody (H00001901-D01P).

Blogs on S1P1/EDG-1

There are no specific blogs for S1P1/EDG-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S1P1/EDG-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S1PR1
Entrez
Uniprot