S1P1/EDG-1 Antibody (2E12.)


Western Blot: S1P1/EDG-1 Antibody (2E12) [H00001901-M01] - EDG1 monoclonal antibody (M01), clone 2E12 Analysis of EDG1 expression in Jurkat.
Western Blot: S1P1/EDG-1 Antibody (2E12) [H00001901-M01] - Analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M01), clone 2E12.Lane 1: EDG1 transfected lysate(42.8 KDa).Lane 2: ...read more
Sandwich ELISA: S1P1/EDG-1 Antibody (2E12) [H00001901-M01] - Detection limit for recombinant GST tagged EDG1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

S1P1/EDG-1 Antibody (2E12.) Summary

EDG1 (AAH18650, 1 a.a. - 47 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
EDG1 - endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S1P1/EDG-1 Antibody (2E12.)

  • CD363 antigen
  • CD363
  • CHEDG1
  • D1S3362
  • EDG1
  • EDG-1
  • EDG1edg-1
  • Endothelial differentiation G-protein coupled receptor 1
  • endothelial differentiation, sphingolipid G-protein-coupled receptor, 1
  • FLJ58121
  • S1P receptor 1
  • S1P receptor Edg-1
  • S1P1
  • S1P1ECGF1
  • S1PR1
  • sphingosine 1-phosphate receptor 1
  • sphingosine 1-phosphate receptor EDG1
  • Sphingosine 1-phosphate receptor Edg-1
  • sphingosine-1-phosphate receptor 1


The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm, Xp
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
Species: Hu

Publications for S1P1/EDG-1 Antibody (H00001901-M01) (0)

There are no publications for S1P1/EDG-1 Antibody (H00001901-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S1P1/EDG-1 Antibody (H00001901-M01) (0)

There are no reviews for S1P1/EDG-1 Antibody (H00001901-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S1P1/EDG-1 Antibody (H00001901-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional S1P1/EDG-1 Products

Bioinformatics Tool for S1P1/EDG-1 Antibody (H00001901-M01)

Discover related pathways, diseases and genes to S1P1/EDG-1 Antibody (H00001901-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S1P1/EDG-1 Antibody (H00001901-M01)

Discover more about diseases related to S1P1/EDG-1 Antibody (H00001901-M01).

Pathways for S1P1/EDG-1 Antibody (H00001901-M01)

View related products by pathway.

PTMs for S1P1/EDG-1 Antibody (H00001901-M01)

Learn more about PTMs related to S1P1/EDG-1 Antibody (H00001901-M01).

Research Areas for S1P1/EDG-1 Antibody (H00001901-M01)

Find related products by research area.

Blogs on S1P1/EDG-1

There are no specific blogs for S1P1/EDG-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our S1P1/EDG-1 Antibody (2E12.) and receive a gift card or discount.


Gene Symbol S1PR1