S100A8 Antibody


Western Blot: S100A8 Antibody [NBP1-79888] - Titration: 1.0 ug/ml Positive Control: ACHN Whole Cell.
Immunohistochemistry: S100A8 Antibody [NBP1-79888] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Secreted Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 ...read more
Immunohistochemistry: S100A8 Antibody [NBP1-79888] - Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue Observed Staining: Cytoplasm in endothelial cells in capillaries Primary Antibody Concentration: N/A Other ...read more

Product Details

Product Discontinued
View other related S100A8 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

S100A8 Antibody Summary

The specific Immunogen is proprietary information. Peptide sequence QYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against S100A8 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for S100A8 Antibody

  • 60B8AG
  • CAGACP-10
  • Calgranulin A
  • calgranulin-A
  • Calprotectin L1L subunit
  • CFAG
  • CFAGL1Ag
  • CGLA
  • Cystic fibrosis antigen
  • Leukocyte L1 complex light chain
  • MA387
  • MIF
  • Migration inhibitory factor-related protein 8
  • MRP8
  • MRP-8
  • MRP8S100 calcium binding protein A8 (calgranulin A)
  • NIF
  • P8
  • protein S100-A8
  • S100 calcium binding protein A8
  • S100 calcium-binding protein A8 (calgranulin A)
  • S100 calcium-binding protein A8
  • S100A8
  • Urinary stone protein band A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF

Publications for S100A8 Antibody (NBP1-79888) (0)

There are no publications for S100A8 Antibody (NBP1-79888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A8 Antibody (NBP1-79888) (0)

There are no reviews for S100A8 Antibody (NBP1-79888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A8 Antibody (NBP1-79888). (Showing 1 - 2 of 2 FAQ).

  1. Have any of your MRP8 antibodies been tested for use in neutralization, or blocking assays, on human samples?
    • Unfortunately at this time we have not tested, or received customer feedback on our MMP8 antibodies for use in blocking or neutralizing assays. If you were planning on testing any of our MMP8 antibodies for neutralizing or blocking capabilities, we would recommend our Innovator’s Reward Program. Under the terms of this program we would be happy to provide a credit for a free vial in exchange for new data on this previously untested or reported application. Please submit this data in the form of an online review. Additional Innovators Reward Program information can be found using this link.
  2. We would like to stain paraffin embedded human intestinal tissue for Calprotectin. One question will be which cells express the majority of Calprotectin - invading neutrophils vs epithelium for example. The antibody list you provide is quite extensive. Which antibody would you recommend for our purpose? Which tissue would you recommend as positive control.
    • Nine of our antibodies to Calprotectin have been validated for IHC-P with human tissue, and you can see all of these products. A number of our IHC images were generated using human spleen samples, and as such this may be a good choice of a positive control tissue. We do sell a human spleen slide product, which is suitable for IHC-P. Unfortunately I do not have an in-depth knowledge of Calprotectin, however the image shown for our antibody with catalogue number NBP1-02826 demonstrates clear staining of neutrophils. The following paper also suggests that the protein is abundant in neutrophils: PMID 11435495.

Secondary Antibodies


Isotype Controls

Additional S100A8 Products

Bioinformatics Tool for S100A8 Antibody (NBP1-79888)

Discover related pathways, diseases and genes to S100A8 Antibody (NBP1-79888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A8 Antibody (NBP1-79888)

Discover more about diseases related to S100A8 Antibody (NBP1-79888).

Pathways for S100A8 Antibody (NBP1-79888)

View related products by pathway.

PTMs for S100A8 Antibody (NBP1-79888)

Learn more about PTMs related to S100A8 Antibody (NBP1-79888).

Research Areas for S100A8 Antibody (NBP1-79888)

Find related products by research area.

Blogs on S100A8

There are no specific blogs for S100A8, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our S100A8 Antibody and receive a gift card or discount.


Gene Symbol S100A8