Recombinant Human S100A7/Psoriasin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related S100A7/Psoriasin Peptides and Proteins

Order Details


    • Catalog Number
      H00006278-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human S100A7/Psoriasin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human S100A7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
S100A7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using
H00006278-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S100A7/Psoriasin Protein

  • HID 5
  • HID5
  • HID-5
  • protein S100-A7
  • PSOR1
  • psoriasin 1
  • Psoriasin
  • S100 calcium binding protein A7 (psoriasin 1)
  • S100 calcium binding protein A7
  • S100 calcium-binding protein A7 (psoriasin 1)
  • S100 calcium-binding protein A7
  • S100A7
  • S100A7c

Background

S100A7( AAH34687, 1 a.a. - 102 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF2758
Species: Hu
Applications: WB, IHC
NBP2-05018
Species: Hu
NBP1-86134
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4870
Species: Hu
Applications: WB, ICC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF4874
Species: Hu
Applications: WB, IHC
H00006275-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006278-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for S100A7/Psoriasin Recombinant Protein (H00006278-P01)(6)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ELISA, Func.


Filter By Application
ELISA
(2)
Func
(4)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 6 of 6.
Publications using H00006278-P01 Applications Species
Vegfors J, Petersson S, Kovacs A et al. The Expression of Psoriasin (S100A7) and CD24 Is Linked and Related to the Differentiation of Mammary Epithelial Cells. PLoS One. 2012 Dec 27 [PMID: 23300877] (Func, Human) Func Human
Vegfors J, Petersson S, Kovacs A et al. The Expression of Psoriasin (S100A7) and CD24 Is Linked and Related to the Differentiation of Mammary Epithelial Cells. PLoS One 2012 Dec 27 [PMID: 23300877] (Func, Human) Func Human
Shubbar E, Vegfors J, Carlstrom M et al. Psoriasin (S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote endothelial cell proliferation. Breast Cancer Res Treat. 2011 Dec 22 [PMID: 22189627] (Func, Human) Func Human
Shubbar E, Vegfors J, Carlstrom M et al. Psoriasin (S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote endothelial cell proliferation. Breast Cancer Res Treat 2011 Dec 22 [PMID: 22189627] (Func, Human) Func Human
Gagnon A, Kim JH, Schorge JO et al. Use of a combination of approaches to identify validate relevant tumor-associated antigens their corresponding autoantibodies in ovarian cancer patients. Clin Cancer Res;14(3):764-771. 2008 Feb 01 [PMID: 18245537] (ELISA, Human) ELISA Human
Gagnon A, Kim JH, Schorge JO et al. Use of a combination of approaches to identify and validate relevant tumor-associated antigens and their corresponding autoantibodies in ovarian cancer patients. Clin Chem 2008 Feb 01 [PMID: 18245537] (ELISA, Human) ELISA Human

Reviews for S100A7/Psoriasin Recombinant Protein (H00006278-P01) (0)

There are no reviews for S100A7/Psoriasin Recombinant Protein (H00006278-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A7/Psoriasin Recombinant Protein (H00006278-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Discover related pathways, diseases and genes to S100A7/Psoriasin Recombinant Protein (H00006278-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Discover more about diseases related to S100A7/Psoriasin Recombinant Protein (H00006278-P01).
 

Pathways for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

View related products by pathway.

PTMs for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Learn more about PTMs related to S100A7/Psoriasin Recombinant Protein (H00006278-P01).
 

Research Areas for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Find related products by research area.

Blogs on S100A7/Psoriasin

There are no specific blogs for S100A7/Psoriasin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human S100A7/Psoriasin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A7
Entrez