Recombinant Human S100A7/Psoriasin Protein (H00006278-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human S100A7/Psoriasin Protein Summary

Description
S100A7/Psoriasin (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
S100A7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00006278-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S100A7/Psoriasin Protein

  • HID 5
  • HID5
  • HID-5
  • protein S100-A7
  • PSOR1
  • psoriasin 1
  • Psoriasin
  • S100 calcium binding protein A7 (psoriasin 1)
  • S100 calcium binding protein A7
  • S100 calcium-binding protein A7 (psoriasin 1)
  • S100 calcium-binding protein A7
  • S100A7
  • S100A7c

Background

S100A7( AAH34687, 1 a.a. - 102 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF2758
Species: Hu
Applications: WB, IHC
H00338324-R01
Species: Hu
NBP2-52884
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4870
Species: Hu
Applications: WB, ICC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF4874
Species: Hu
Applications: WB, IHC
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006278-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for S100A7/Psoriasin Recombinant Protein (H00006278-P01)(3)

Reviews for S100A7/Psoriasin Recombinant Protein (H00006278-P01) (0)

There are no reviews for S100A7/Psoriasin Recombinant Protein (H00006278-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A7/Psoriasin Recombinant Protein (H00006278-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A7/Psoriasin Products

Related Products by Gene

Bioinformatics Tool for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Discover related pathways, diseases and genes to S100A7/Psoriasin Recombinant Protein (H00006278-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Discover more about diseases related to S100A7/Psoriasin Recombinant Protein (H00006278-P01).
 

Pathways for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

View related products by pathway.

PTMs for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Learn more about PTMs related to S100A7/Psoriasin Recombinant Protein (H00006278-P01).
 

Research Areas for S100A7/Psoriasin Recombinant Protein (H00006278-P01)

Find related products by research area.

Blogs on S100A7/Psoriasin

There are no specific blogs for S100A7/Psoriasin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human S100A7/Psoriasin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A7
Entrez