S100A7/Psoriasin Antibody

Images

 
Western Blot: S100A7/Psoriasin Antibody [H00006278-D03P] - Analysis of S100A7 expression in transfected 293T cell line by S100A7 polyclonal antibody.Lane 1: S100A7 transfected lysate(11.22 KDa).Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: S100A7/Psoriasin Antibody [H00006278-D03P] - Analysis of antibody to S100A7 on HeLa cell. Antibody concentration 20 ug/ml.

Product Details

Summary
Product Discontinued
View other related S100A7/Psoriasin Primary Antibodies

Order Details


    • Catalog Number
      H00006278-D03P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

S100A7/Psoriasin Antibody Summary

Immunogen
S100A7 (AAH34687.1, 1 a.a. - 101 a.a.) full-length human protein. MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Specificity
S100A7 - S100 calcium binding protein A7,
Clonality
Polyclonal
Host
Rabbit
Gene
S100A7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A7/Psoriasin Antibody

  • HID 5
  • HID5
  • HID-5
  • protein S100-A7
  • PSOR1
  • psoriasin 1
  • Psoriasin
  • S100 calcium binding protein A7 (psoriasin 1)
  • S100 calcium binding protein A7
  • S100 calcium-binding protein A7 (psoriasin 1)
  • S100 calcium-binding protein A7
  • S100A7
  • S100A7c

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF2758
Species: Hu
Applications: WB, IHC
NBP2-23450
Species: Mu
NBP2-52884
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4870
Species: Hu
Applications: WB, ICC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF4874
Species: Hu
Applications: WB, IHC
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006278-D03P
Species: Hu
Applications: WB, ICC/IF

Publications for Psoriasin/S100A7 Antibody (H00006278-D03P) (0)

There are no publications for Psoriasin/S100A7 Antibody (H00006278-D03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Psoriasin/S100A7 Antibody (H00006278-D03P) (0)

There are no reviews for Psoriasin/S100A7 Antibody (H00006278-D03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Psoriasin/S100A7 Antibody (H00006278-D03P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A7/Psoriasin Products

Bioinformatics Tool for Psoriasin/S100A7 Antibody (H00006278-D03P)

Discover related pathways, diseases and genes to Psoriasin/S100A7 Antibody (H00006278-D03P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Psoriasin/S100A7 Antibody (H00006278-D03P)

Discover more about diseases related to Psoriasin/S100A7 Antibody (H00006278-D03P).
 

Pathways for Psoriasin/S100A7 Antibody (H00006278-D03P)

View related products by pathway.

PTMs for Psoriasin/S100A7 Antibody (H00006278-D03P)

Learn more about PTMs related to Psoriasin/S100A7 Antibody (H00006278-D03P).
 

Research Areas for Psoriasin/S100A7 Antibody (H00006278-D03P)

Find related products by research area.

Blogs on S100A7/Psoriasin

There are no specific blogs for S100A7/Psoriasin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A7/Psoriasin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A7
Entrez
Uniprot