S100A6 Antibody (6D1)

Images

 
Western Blot: S100A6 Antibody (6D1) [H00006277-M16] - Analysis of S100A6 expression in HeLa (Cat # L013V1).
Western Blot: S100A6 Antibody (6D1) [H00006277-M16] - Analysis of S100A6 expression in transfected 293T cell line by S100A6 monoclonal antibody (M16), clone 6D1. Lane 1: S100A6 transfected lysatE (10.2 KDa). Lane 2: ...read more
Sandwich ELISA: S100A6 Antibody (6D1) [H00006277-M16] - Detection limit for recombinant GST tagged S100A6 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100A6 Antibody (6D1) Summary

Immunogen
S100A6 (NP_055439, 18 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYSEALKG
Specificity
S100A6 - S100 calcium binding protein A6 (calcyclin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00006277-M16.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A6 Antibody (6D1)

  • 2A9
  • CABP
  • CACY
  • CACY5B10
  • calcyclin
  • Growth factor-inducible protein 2A9
  • MLN 4
  • PRA
  • PRAS100 calcium binding protein A6 (calcyclin)
  • Prolactin receptor-associated protein
  • protein S100-A6
  • S100 calcium binding protein A6
  • S100 calcium-binding protein A6 (calcyclin)
  • S100 calcium-binding protein A6
  • S100A6

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-07799
Species: Hu
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for S100A6 Antibody (H00006277-M16)(3)

Reviews for S100A6 Antibody (H00006277-M16) (0)

There are no reviews for S100A6 Antibody (H00006277-M16). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A6 Antibody (H00006277-M16) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A6 Products

Bioinformatics Tool for S100A6 Antibody (H00006277-M16)

Discover related pathways, diseases and genes to S100A6 Antibody (H00006277-M16). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A6 Antibody (H00006277-M16)

Discover more about diseases related to S100A6 Antibody (H00006277-M16).
 

Pathways for S100A6 Antibody (H00006277-M16)

View related products by pathway.

PTMs for S100A6 Antibody (H00006277-M16)

Learn more about PTMs related to S100A6 Antibody (H00006277-M16).
 

Research Areas for S100A6 Antibody (H00006277-M16)

Find related products by research area.

Blogs on S100A6.

S100A6: Playing Roles in Cancer, Apoptosis & Transcription Regulation
S100A6 antibodies detect a small calcium binding protein with 2 EF-hand structures and belongs to the S100 family. Calcium binding induces a conformational change of the protein which in turn permits its interaction with several target proteins. It is...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A6 Antibody (6D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A6
Entrez
OMIM
Uniprot