S100A6 Antibody (6B5) [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related S100A6 Primary Antibodies

Order Details


    • Catalog Number
      H00006277-M10AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

S100A6 Antibody (6B5) [Alexa Fluor® 405] Summary

Immunogen
S100A6 (AAH01431, 1 a.a. - 90 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Specificity
S100A6 - S100 calcium binding protein A6 (calcyclin)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for S100A6 Antibody (6B5) [Alexa Fluor® 405]

  • 2A9
  • CABP
  • CACY
  • CACY5B10
  • calcyclin
  • Growth factor-inducible protein 2A9
  • MLN 4
  • PRA
  • PRAS100 calcium binding protein A6 (calcyclin)
  • Prolactin receptor-associated protein
  • protein S100-A6
  • S100 calcium binding protein A6
  • S100 calcium-binding protein A6 (calcyclin)
  • S100 calcium-binding protein A6
  • S100A6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-07799
Species: Hu
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for S100A6 Antibody (H00006277-M10AF405) (0)

There are no publications for S100A6 Antibody (H00006277-M10AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A6 Antibody (H00006277-M10AF405) (0)

There are no reviews for S100A6 Antibody (H00006277-M10AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A6 Antibody (H00006277-M10AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A6 Products

Bioinformatics Tool for S100A6 Antibody (H00006277-M10AF405)

Discover related pathways, diseases and genes to S100A6 Antibody (H00006277-M10AF405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A6 Antibody (H00006277-M10AF405)

Discover more about diseases related to S100A6 Antibody (H00006277-M10AF405).
 

Pathways for S100A6 Antibody (H00006277-M10AF405)

View related products by pathway.

PTMs for S100A6 Antibody (H00006277-M10AF405)

Learn more about PTMs related to S100A6 Antibody (H00006277-M10AF405).
 

Research Areas for S100A6 Antibody (H00006277-M10AF405)

Find related products by research area.

Blogs on S100A6.

S100A6: Playing Roles in Cancer, Apoptosis & Transcription Regulation
S100A6 antibodies detect a small calcium binding protein with 2 EF-hand structures and belongs to the S100 family. Calcium binding induces a conformational change of the protein which in turn permits its interaction with several target proteins. It is...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A6 Antibody (6B5) [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A6
Entrez