Recombinant Human S100A5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human S100A5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32874 of Human S100A5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
S100A5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human S100A5 Protein

  • Protein S-100D
  • S100 calcium binding protein A5
  • S100 calcium-binding protein A5S100Dprotein S100-A5

Background

S100A5 - S100 calcium binding protein A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-86039
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB2957
Species: Hu
Applications: WB, ICC, KO
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4874
Species: Hu
Applications: WB, IHC
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-90000
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for S100A5 Partial Recombinant Protein (H00006276-Q01) (0)

There are no publications for S100A5 Partial Recombinant Protein (H00006276-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A5 Partial Recombinant Protein (H00006276-Q01) (0)

There are no reviews for S100A5 Partial Recombinant Protein (H00006276-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A5 Partial Recombinant Protein (H00006276-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A5 Products

Bioinformatics Tool for S100A5 Partial Recombinant Protein (H00006276-Q01)

Discover related pathways, diseases and genes to S100A5 Partial Recombinant Protein (H00006276-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A5 Partial Recombinant Protein (H00006276-Q01)

Discover more about diseases related to S100A5 Partial Recombinant Protein (H00006276-Q01).
 

Pathways for S100A5 Partial Recombinant Protein (H00006276-Q01)

View related products by pathway.

Blogs on S100A5

There are no specific blogs for S100A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

S100A5 Antibody
NBP2-56319

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human S100A5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A5