S100A5 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

S100A5 Partial Recombinant Protein Summary

Description
S100A5 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY
Preparation
Method
in vitro wheat germ expression system
Gene
S100A5

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A5 Partial Recombinant Protein

  • Protein S-100D
  • S100 calcium binding protein A5
  • S100 calcium-binding protein A5S100Dprotein S100-A5

Background

S100A5 - S100 calcium binding protein A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
H00006275-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF4870
Species: Hu
Applications: WB, ICC
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-86039
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF2957
Species: Hu
Applications: WB, IHC
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
AF4874
Species: Hu
Applications: WB, IHC
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03950
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB
H00006276-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for S100A5 Partial Recombinant Protein (H00006276-Q01) (0)

There are no publications for S100A5 Partial Recombinant Protein (H00006276-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A5 Partial Recombinant Protein (H00006276-Q01) (0)

There are no reviews for S100A5 Partial Recombinant Protein (H00006276-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A5 Partial Recombinant Protein (H00006276-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional S100A5 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for S100A5 Partial Recombinant Protein (H00006276-Q01)

Discover related pathways, diseases and genes to S100A5 Partial Recombinant Protein (H00006276-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A5 Partial Recombinant Protein (H00006276-Q01)

Discover more about diseases related to S100A5 Partial Recombinant Protein (H00006276-Q01).
 

Pathways for S100A5 Partial Recombinant Protein (H00006276-Q01)

View related products by pathway.

Blogs on S100A5

There are no specific blogs for S100A5, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our S100A5 Partial Recombinant Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A5

Customers Who Bought This Also Bought