S100A4 Antibody

Images

 
Western Blot: S100A4 Antibody [H00006275-B03P] - Analysis of S100A4 expression in transfected 293T cell line. Lane 1: S100A4 transfected lysate (11.70 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100A4 Antibody Summary

Immunogen
S100A4 (NP_002952.1, 1 a.a. - 101 a.a.) full-length human protein. MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
S100A4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A4 Antibody

  • 18A2
  • 42A
  • Calvasculin
  • CAPL
  • CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin
  • fibroblast-specific protein-1,42A
  • FSP1
  • leukemia multidrug resistance associated protein
  • malignant transformation suppression 1
  • Metastasin
  • MTS1
  • murine placental homolog)
  • P9KA
  • PEL98
  • Placental calcium-binding protein
  • Protein Mts1
  • protein S100-A4
  • S100 calcium binding protein A4
  • S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
  • S100 calcium-binding protein A4
  • S100A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006275-B03P
Species: Hu
Applications: WB

Publications for S100A4 Antibody (H00006275-B03P) (0)

There are no publications for S100A4 Antibody (H00006275-B03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A4 Antibody (H00006275-B03P) (0)

There are no reviews for S100A4 Antibody (H00006275-B03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for S100A4 Antibody (H00006275-B03P). (Showing 1 - 1 of 1 FAQ).

  1. Does this antibody have neutralizing function?
    • This antibody has never been tested in neutralizing experiment and there is no guarantee it works. If you would be interested in testing this novel application, please take a look at our Innovator's Reward program.

Secondary Antibodies

 

Isotype Controls

Additional S100A4 Products

Bioinformatics Tool for S100A4 Antibody (H00006275-B03P)

Discover related pathways, diseases and genes to S100A4 Antibody (H00006275-B03P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A4 Antibody (H00006275-B03P)

Discover more about diseases related to S100A4 Antibody (H00006275-B03P).
 

Pathways for S100A4 Antibody (H00006275-B03P)

View related products by pathway.

PTMs for S100A4 Antibody (H00006275-B03P)

Learn more about PTMs related to S100A4 Antibody (H00006275-B03P).
 

Research Areas for S100A4 Antibody (H00006275-B03P)

Find related products by research area.

Blogs on S100A4.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A4
Entrez
Uniprot