S100A4 Antibody (1F12-1G7) [DyLight 550] (H00006275-M01IR)

Images

 
There are currently no images for S100A4 Antibody (H00006275-M01IR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1F12-1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 550

Order Details

View Available Conjugates
Catalog# & Conjugate Size Price

S100A4 Antibody (1F12-1G7) [DyLight 550] Summary

Immunogen
S100A4 (AAH16300, 1 a.a. - 101 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Specificity
S100A4 - S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A4 Antibody (1F12-1G7) [DyLight 550]

  • 18A2
  • 42A
  • Calvasculin
  • CAPL
  • CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin
  • fibroblast-specific protein-1,42A
  • FSP1
  • leukemia multidrug resistance associated protein
  • malignant transformation suppression 1
  • Metastasin
  • MTS1
  • murine placental homolog)
  • P9KA
  • PEL98
  • Placental calcium-binding protein
  • Protein Mts1
  • protein S100-A4
  • S100 calcium binding protein A4
  • S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
  • S100 calcium-binding protein A4
  • S100A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006275-M01IR
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC

Publications for S100A4 Antibody (H00006275-M01IR) (0)

There are no publications for S100A4 Antibody (H00006275-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A4 Antibody (H00006275-M01IR) (0)

There are no reviews for S100A4 Antibody (H00006275-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A4 Antibody (H00006275-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A4 Products

Related Products by Gene

Bioinformatics Tool for S100A4 Antibody (H00006275-M01IR)

Discover related pathways, diseases and genes to S100A4 Antibody (H00006275-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A4 Antibody (H00006275-M01IR)

Discover more about diseases related to S100A4 Antibody (H00006275-M01IR).
 

Pathways for S100A4 Antibody (H00006275-M01IR)

View related products by pathway.

PTMs for S100A4 Antibody (H00006275-M01IR)

Learn more about PTMs related to S100A4 Antibody (H00006275-M01IR).
 

Research Areas for S100A4 Antibody (H00006275-M01IR)

Find related products by research area.

Blogs on S100A4.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A4 Antibody (1F12-1G7) [DyLight 550] and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A4
Entrez