S100A2 Antibody (M2) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related S100A2 Primary Antibodies

Order Details


    • Catalog Number
      H00006273-M06PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

S100A2 Antibody (M2) [PerCP] Summary

Immunogen
S100A2 (AAH02829, 1 a.a. - 97 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Specificity
S100A2 - S100 calcium binding protein A2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A2 Antibody (M2) [PerCP]

  • CAN19
  • CAN19protein S100-A2
  • MGC111539
  • S100 calcium binding protein A2
  • S100 calcium-binding protein A2Protein S-100L
  • S100A2
  • S100L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF4874
Species: Hu
Applications: WB, IHC
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-54679
Species: Hu
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-56559
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB2957
Species: Hu
Applications: WB, ICC, KO
NBP2-56319
Species: Hu
Applications: ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S100A2 Antibody (H00006273-M06PCP) (0)

There are no publications for S100A2 Antibody (H00006273-M06PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for S100A2 Antibody (H00006273-M06PCP) (0)

There are no reviews for S100A2 Antibody (H00006273-M06PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A2 Antibody (H00006273-M06PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A2 Products

Bioinformatics Tool for S100A2 Antibody (H00006273-M06PCP)

Discover related pathways, diseases and genes to S100A2 Antibody (H00006273-M06PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A2 Antibody (H00006273-M06PCP)

Discover more about diseases related to S100A2 Antibody (H00006273-M06PCP).
 

Pathways for S100A2 Antibody (H00006273-M06PCP)

View related products by pathway.

PTMs for S100A2 Antibody (H00006273-M06PCP)

Learn more about PTMs related to S100A2 Antibody (H00006273-M06PCP).
 

Research Areas for S100A2 Antibody (H00006273-M06PCP)

Find related products by research area.

Blogs on S100A2

There are no specific blogs for S100A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A2 Antibody (M2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A2
Entrez