RWDD1 Antibody

Images

 
Western Blot: RWDD1 Antibody [NBP3-10273] - Western blot analysis of RWDD1 in Human MCF7 Whole Cell lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RWDD1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RWDD1 (NP_001007465.1). Peptide sequence KQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYN
Clonality
Polyclonal
Host
Rabbit
Gene
RWDD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for RWDD1 Antibody

  • DFRP2
  • DRG family-regulatory protein 2
  • PTD013
  • RWD domain containing 1
  • RWD domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY262
Species: Hu
Applications: ELISA
NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89461
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-86745
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
NBP1-81312
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-82591
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75618
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-28727
Species: Hu
Applications: IHC, IHC-P, IP (-), IP, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-15419
Species: Mu, Rt
Applications: WB
NBP3-03905
Species: Hu, Mu, Rt
Applications: WB
H00003841-M01
Species: Hu
Applications: ELISA, IP, KD, WB
NBP3-16867
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-10273
Species: Hu
Applications: WB

Publications for RWDD1 Antibody (NBP3-10273) (0)

There are no publications for RWDD1 Antibody (NBP3-10273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RWDD1 Antibody (NBP3-10273) (0)

There are no reviews for RWDD1 Antibody (NBP3-10273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RWDD1 Antibody (NBP3-10273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RWDD1 Products

Bioinformatics Tool for RWDD1 Antibody (NBP3-10273)

Discover related pathways, diseases and genes to RWDD1 Antibody (NBP3-10273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RWDD1 Antibody (NBP3-10273)

View related products by pathway.

Blogs on RWDD1

There are no specific blogs for RWDD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RWDD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RWDD1