RUNX3/CBFA3 Antibody

Images

 
Western Blot: RUNX3/CBFA3 Antibody [H00000864-B01P] - Analysis of RUNX3 expression in human pancreas.
Immunocytochemistry/ Immunofluorescence: RUNX3/CBFA3 Antibody [H00000864-B01P] - Analysis of purified antibody to RUNX3 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: RUNX3/CBFA3 Antibody [H00000864-B01P] - Analysis of purified antibody to RUNX3 on formalin-fixed paraffin-embedded human endometrium. (antibody concentration 3 ug/ml)
Western Blot: RUNX3/CBFA3 Antibody [H00000864-B01P] - Analysis of RUNX3 expression in transfected 293T cell line by RUNX3 polyclonal antibody. Lane 1: RUNX3 transfected lysate(47.19 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RUNX3/CBFA3 Antibody Summary

Immunogen
RUNX3 (AAH13362.1, 1 a.a. - 429 a.a.) full-length human protein. MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RUNX3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for WB and IF.
Publications
Read Publications using H00000864-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX3/CBFA3 Antibody

  • Acute myeloid leukemia 2 protein
  • AML2
  • AML2SL3/AKV core-binding factor alpha C subunit
  • CBFA3
  • CBFA3MGC16070
  • CBF-alpha-3
  • PEA2 alpha C
  • PEA2-alpha C
  • PEBP2 alpha C
  • PEBP2A3
  • PEBP2A3FLJ34510
  • PEBP2AC
  • PEBP2-alpha C
  • runt domain, alpha subunit 3
  • runt-related transcription factor 3
  • RUNX3
  • SL3-3 enhancer factor 1 alpha C subunit
  • transcription factor AML2

Background

This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56552
Species: Hu
Applications: WB
NB100-56637
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF4885
Species: Mu
Applications: WB, IP
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RUNX3/CBFA3 Antibody (H00000864-B01P)(2)

Reviews for RUNX3/CBFA3 Antibody (H00000864-B01P) (0)

There are no reviews for RUNX3/CBFA3 Antibody (H00000864-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX3/CBFA3 Antibody (H00000864-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX3/CBFA3 Products

Bioinformatics Tool for RUNX3/CBFA3 Antibody (H00000864-B01P)

Discover related pathways, diseases and genes to RUNX3/CBFA3 Antibody (H00000864-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX3/CBFA3 Antibody (H00000864-B01P)

Discover more about diseases related to RUNX3/CBFA3 Antibody (H00000864-B01P).
 

Pathways for RUNX3/CBFA3 Antibody (H00000864-B01P)

View related products by pathway.

PTMs for RUNX3/CBFA3 Antibody (H00000864-B01P)

Learn more about PTMs related to RUNX3/CBFA3 Antibody (H00000864-B01P).
 

Research Areas for RUNX3/CBFA3 Antibody (H00000864-B01P)

Find related products by research area.

Blogs on RUNX3/CBFA3

There are no specific blogs for RUNX3/CBFA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX3/CBFA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX3
Entrez
Uniprot