RUNX2/CBFA1 Antibody

Images

 
Western Blot: RUNX2 Antibody [NBP1-69178] - Titration: 0.2-1 ug/ml, Positive Control: Rat Liver.

Product Details

Summary
Product Discontinued
View other related RUNX2/CBFA1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69178
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RUNX2/CBFA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Runx2 (runt-related transcription factor 2) The peptide sequence was selected from the C terminal of Runx2. Peptide sequence PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY.
Clonality
Polyclonal
Host
Rabbit
Gene
RUNX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Runx2 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RUNX2/CBFA1 Antibody

  • Acute myeloid leukemia 3 protein
  • AML3CCD
  • CBFA1
  • CBFA1MGC120022
  • Core-binding factor subunit alpha-1
  • MGC120023
  • PEA2-alpha A
  • PEBP2A
  • PEBP2A1CCD1
  • PEBP2aA1
  • PEBP2-alpha A
  • runt domain, alpha subunit 1
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Background

The function of Runx2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
355-BM/CF
Species: Hu, Mu, Rt
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF3075
Species: Hu
Applications: WB, ICC

Publications for RUNX2/CBFA1 Antibody (NBP1-69178) (0)

There are no publications for RUNX2/CBFA1 Antibody (NBP1-69178).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX2/CBFA1 Antibody (NBP1-69178) (0)

There are no reviews for RUNX2/CBFA1 Antibody (NBP1-69178). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RUNX2/CBFA1 Antibody (NBP1-69178). (Showing 1 - 1 of 1 FAQ).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Secondary Antibodies

 

Isotype Controls

Additional RUNX2/CBFA1 Products

Bioinformatics Tool for RUNX2/CBFA1 Antibody (NBP1-69178)

Discover related pathways, diseases and genes to RUNX2/CBFA1 Antibody (NBP1-69178). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX2/CBFA1 Antibody (NBP1-69178)

Discover more about diseases related to RUNX2/CBFA1 Antibody (NBP1-69178).
 

Pathways for RUNX2/CBFA1 Antibody (NBP1-69178)

View related products by pathway.

PTMs for RUNX2/CBFA1 Antibody (NBP1-69178)

Learn more about PTMs related to RUNX2/CBFA1 Antibody (NBP1-69178).

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX2/CBFA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2
Entrez