RUNX2/CBFA1 Antibody


Western Blot: RUNX2/CBFA1 Antibody [NBP1-52859] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: RUNX2/CBFA1 Antibody [NBP1-52859] - Reccomended Titration: 1.25 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate

Product Details

Product Discontinued
View other related RUNX2/CBFA1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RUNX2/CBFA1 Antibody Summary

Synthetic peptides corresponding to RUNX2 (runt-related transcription factor 2) The peptide sequence was selected from the middle region of RUNX2. Peptide sequence DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RUNX2 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
RUNX2/CBFA1 Lysate (NBP2-65102)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RUNX2/CBFA1 Antibody

  • Acute myeloid leukemia 3 protein
  • CBFA1
  • CBFA1MGC120022
  • Core-binding factor subunit alpha-1
  • MGC120023
  • PEA2-alpha A
  • PEBP2A
  • PEBP2aA1
  • PEBP2-alpha A
  • runt domain, alpha subunit 1
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit


RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB

Publications for RUNX2/CBFA1 Antibody (NBP1-52859) (0)

There are no publications for RUNX2/CBFA1 Antibody (NBP1-52859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX2/CBFA1 Antibody (NBP1-52859) (0)

There are no reviews for RUNX2/CBFA1 Antibody (NBP1-52859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RUNX2/CBFA1 Antibody (NBP1-52859). (Showing 1 - 1 of 1 FAQ).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RUNX2/CBFA1 Antibody (NBP1-52859)

Discover related pathways, diseases and genes to RUNX2/CBFA1 Antibody (NBP1-52859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX2/CBFA1 Antibody (NBP1-52859)

Discover more about diseases related to RUNX2/CBFA1 Antibody (NBP1-52859).

Pathways for RUNX2/CBFA1 Antibody (NBP1-52859)

View related products by pathway.

PTMs for RUNX2/CBFA1 Antibody (NBP1-52859)

Learn more about PTMs related to RUNX2/CBFA1 Antibody (NBP1-52859).

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RUNX2/CBFA1 Antibody and receive a gift card or discount.


Gene Symbol RUNX2