RUNX1T1/ETO Antibody (5A12) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related RUNX1T1/ETO Primary Antibodies

Order Details


    • Catalog Number
      H00000862-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RUNX1T1/ETO Antibody (5A12) [PE] Summary

Immunogen
RUNX1T1 (NP_004340 416 a.a. - 525 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG
Specificity
RUNX1T1 - runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RUNX1T1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX1T1/ETO Antibody (5A12) [PE]

  • AML1T1protein CBFA2T1
  • CBFA2T1Cyclin-D-related protein
  • CDRMGC2796
  • core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related
  • DKFZp564B213
  • Eight twenty one protein
  • ETOFLJ33145
  • MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related
  • Protein ETO
  • Protein MTG8
  • runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
  • Zinc finger MYND domain-containing protein 2
  • ZMYND2myeloid translocation gene on 8q22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57758
Species: Hu
Applications: ICC/IF
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-56012
Species: Hu
Applications: ICC/IF
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
21370002
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00000862-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RUNX1T1/ETO Antibody (H00000862-M01PE) (0)

There are no publications for RUNX1T1/ETO Antibody (H00000862-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX1T1/ETO Antibody (H00000862-M01PE) (0)

There are no reviews for RUNX1T1/ETO Antibody (H00000862-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1T1/ETO Antibody (H00000862-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX1T1/ETO Products

Bioinformatics Tool for RUNX1T1/ETO Antibody (H00000862-M01PE)

Discover related pathways, diseases and genes to RUNX1T1/ETO Antibody (H00000862-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1T1/ETO Antibody (H00000862-M01PE)

Discover more about diseases related to RUNX1T1/ETO Antibody (H00000862-M01PE).
 

Pathways for RUNX1T1/ETO Antibody (H00000862-M01PE)

View related products by pathway.

PTMs for RUNX1T1/ETO Antibody (H00000862-M01PE)

Learn more about PTMs related to RUNX1T1/ETO Antibody (H00000862-M01PE).

Blogs on RUNX1T1/ETO

There are no specific blogs for RUNX1T1/ETO, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX1T1/ETO Antibody (5A12) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX1T1