RUNX1/CBFA2 Antibody (4E7.) [Allophycocyanin]

Images

 

Product Details

Summary
Product Discontinued
View other related RUNX1/CBFA2 Primary Antibodies

Order Details


    • Catalog Number
      H00000861-M05APC
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RUNX1/CBFA2 Antibody (4E7.) [Allophycocyanin] Summary

Immunogen
RUNX1 (NP_001001890.1 210 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Specificity
RUNX1 (4E7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RUNX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX1/CBFA2 Antibody (4E7.) [Allophycocyanin]

  • Acute myeloid leukemia 1 protein
  • AML1
  • AML1acute myeloid leukemia 1
  • AML1-EVI-1
  • CBFA2
  • CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
  • Core-binding factor subunit alpha-2
  • EVI-1
  • PEBP2A2
  • runt domain, alpha subunit 2
  • runt-related transcription factor 1
  • RUNX1
  • SL3/AKV core-binding factor alpha B subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
AF5414
Species: Hu
Applications: WB, Simple Western
NB600-248
Species: Hu
Applications: WB, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
MAB17791
Species: Hu, Mu
Applications: WB
AF7349
Species: Hu, Mu
Applications: WB, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000861-M05APC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RUNX1/CBFA2 Antibody (H00000861-M05APC) (0)

There are no publications for RUNX1/CBFA2 Antibody (H00000861-M05APC).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX1/CBFA2 Antibody (H00000861-M05APC) (0)

There are no reviews for RUNX1/CBFA2 Antibody (H00000861-M05APC). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1/CBFA2 Antibody (H00000861-M05APC) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RUNX1/CBFA2 Products

Bioinformatics Tool for RUNX1/CBFA2 Antibody (H00000861-M05APC)

Discover related pathways, diseases and genes to RUNX1/CBFA2 Antibody (H00000861-M05APC). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1/CBFA2 Antibody (H00000861-M05APC)

Discover more about diseases related to RUNX1/CBFA2 Antibody (H00000861-M05APC).
 

Pathways for RUNX1/CBFA2 Antibody (H00000861-M05APC)

View related products by pathway.

PTMs for RUNX1/CBFA2 Antibody (H00000861-M05APC)

Learn more about PTMs related to RUNX1/CBFA2 Antibody (H00000861-M05APC).
 

Research Areas for RUNX1/CBFA2 Antibody (H00000861-M05APC)

Find related products by research area.

Blogs on RUNX1/CBFA2

There are no specific blogs for RUNX1/CBFA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX1/CBFA2 Antibody (4E7.) [Allophycocyanin] and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX1
Entrez