RUNX1/CBFA2 Antibody (4E7.)

Images

 
Western Blot: RUNX1/CBFA2 Antibody (4E7) [H00000861-M05] - Analysis of RUNX1 expression in K-562.
Immunocytochemistry/ Immunofluorescence: RUNX1/CBFA2 Antibody (4E7) [H00000861-M05] - Analysis of monoclonal antibody to RUNX1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody (4E7) [H00000861-M05] - Analysis of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Western Blot: RUNX1/CBFA2 Antibody (4E7) [H00000861-M05] - Western Blot analysis of RUNX1 expression in Hela NE ( Cat # L013V3 ).
Western Blot: RUNX1/CBFA2 Antibody (4E7) [H00000861-M05] - Western Blot analysis of RUNX1 expression in NIH/3T3 ( Cat # L018V1 ).
ELISA: RUNX1/CBFA2 Antibody (4E7) [H00000861-M05] - Detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RUNX1/CBFA2 Antibody (4E7.) Summary

Immunogen
RUNX1 (NP_001001890.1 210 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP
Specificity
RUNX1 (4E7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RUNX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Positive Control
HeLa Lysate (NB800-PC9)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX1/CBFA2 Antibody (4E7.)

  • Acute myeloid leukemia 1 protein
  • AML1
  • AML1acute myeloid leukemia 1
  • AML1-EVI-1
  • CBFA2
  • CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1
  • Core-binding factor subunit alpha-2
  • EVI-1
  • PEBP2A2
  • runt domain, alpha subunit 2
  • runt-related transcription factor 1
  • RUNX1
  • SL3/AKV core-binding factor alpha B subunit

Background

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55747
Species: Hu
Applications: WB, ICC/IF
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
AF5414
Species: Hu
Applications: WB, Simple Western
NB600-248
Species: Hu
Applications: WB, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19097
Species: Hu
Applications: Flow, ICC/IF, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP1-33757
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-47291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7349
Species: Hu, Mu
Applications: WB, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for RUNX1/CBFA2 Antibody (H00000861-M05) (0)

There are no publications for RUNX1/CBFA2 Antibody (H00000861-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX1/CBFA2 Antibody (H00000861-M05) (0)

There are no reviews for RUNX1/CBFA2 Antibody (H00000861-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX1/CBFA2 Antibody (H00000861-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RUNX1/CBFA2 Antibody (H00000861-M05)

Discover related pathways, diseases and genes to RUNX1/CBFA2 Antibody (H00000861-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX1/CBFA2 Antibody (H00000861-M05)

Discover more about diseases related to RUNX1/CBFA2 Antibody (H00000861-M05).
 

Pathways for RUNX1/CBFA2 Antibody (H00000861-M05)

View related products by pathway.

PTMs for RUNX1/CBFA2 Antibody (H00000861-M05)

Learn more about PTMs related to RUNX1/CBFA2 Antibody (H00000861-M05).
 

Research Areas for RUNX1/CBFA2 Antibody (H00000861-M05)

Find related products by research area.

Blogs on RUNX1/CBFA2

There are no specific blogs for RUNX1/CBFA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX1/CBFA2 Antibody (4E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX1
Entrez
OMIM
Uniprot