RTN1 Antibody

Images

 
Western Blot: RTN1 Antibody [NBP1-59670] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related RTN1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59670
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RTN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RTN1(reticulon 1) The peptide sequence was selected from the middle region of RTN1. Peptide sequence MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE.
Clonality
Polyclonal
Host
Rabbit
Gene
RTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RTN1 and was validated on Western blot.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RTN1 Antibody

  • Neuroendocrine-specific proteinNSPMGC133250
  • reticulon 1
  • reticulon-1

Background

Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. Alternatively spliced transcript variants encoding different isoforms have been identified. Multiple promoters rather than alternative splicing of internal exons seem to be involved in this diversity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4077
Species: Hu
Applications: WB, IHC
MAB6967
Species: Hu
Applications: WB
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP2-12553
Species: Hu
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB8630
Species: Hu
Applications: WB, IHC
NBP2-45945
Species: Hu
Applications: WB, Flow, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13306
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RTN1 Antibody (NBP1-59670) (0)

There are no publications for RTN1 Antibody (NBP1-59670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTN1 Antibody (NBP1-59670) (0)

There are no reviews for RTN1 Antibody (NBP1-59670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RTN1 Antibody (NBP1-59670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTN1 Products

Bioinformatics Tool for RTN1 Antibody (NBP1-59670)

Discover related pathways, diseases and genes to RTN1 Antibody (NBP1-59670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTN1 Antibody (NBP1-59670)

Discover more about diseases related to RTN1 Antibody (NBP1-59670).
 

Pathways for RTN1 Antibody (NBP1-59670)

View related products by pathway.

PTMs for RTN1 Antibody (NBP1-59670)

Learn more about PTMs related to RTN1 Antibody (NBP1-59670).
 

Research Areas for RTN1 Antibody (NBP1-59670)

Find related products by research area.

Blogs on RTN1

There are no specific blogs for RTN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN1
Uniprot