RTBDN Antibody

Images

 
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Staining of human rectum shows moderate cytoplasmic positivity in luminal glandular cells.
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Staining of human rectum shows moderate cytoplasmic positivity in luminal glandular cells.
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Staining of breast cancer.
Immunohistochemistry: RTBDN Antibody [NBP2-31918] - Staining of breast cancer.

Product Details

Summary
Product Discontinued
View other related RTBDN Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31918
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RTBDN Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTBDN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RTBDN Antibody

  • FLJ36353
  • retbindin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2945
Species: Hu
Applications: WB
NBP2-01353
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RTBDN Antibody (NBP2-31918) (0)

There are no publications for RTBDN Antibody (NBP2-31918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTBDN Antibody (NBP2-31918) (0)

There are no reviews for RTBDN Antibody (NBP2-31918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RTBDN Antibody (NBP2-31918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTBDN Products

RTBDN NBP2-31918

Bioinformatics Tool for RTBDN Antibody (NBP2-31918)

Discover related pathways, diseases and genes to RTBDN Antibody (NBP2-31918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RTBDN

There are no specific blogs for RTBDN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTBDN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTBDN
Uniprot