RSK3 Antibody (1F6) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RSK3 Primary Antibodies

Order Details


    • Catalog Number
      H00006196-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RSK3 Antibody (1F6) [DyLight 488] Summary

Immunogen
RPS6KA2 (AAH02363 631 a.a. - 733 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Specificity
RPS6KA2 (1F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS6KA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23913705). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RSK3 Antibody (1F6) [DyLight 488]

  • EC 2.7.11
  • EC 2.7.11.1
  • HU-2
  • MAP kinase-activated protein kinase 1c
  • MAPK-activated protein kinase 1c
  • MAPKAP kinase 1c
  • MAPKAPK1C
  • MAPKAPK-1c
  • p90-RSK 2
  • p90RSK2
  • p90-RSK3
  • ribosomal protein S6 kinase alpha 2
  • ribosomal protein S6 kinase alpha-2
  • ribosomal protein S6 kinase, 90kD, polypeptide 2
  • ribosomal protein S6 kinase, 90kDa, polypeptide 2
  • Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2
  • RPS6KA2
  • RSK
  • RSK3
  • RSK-3
  • RSK3pp90RSK3
  • S6K-alpha
  • S6K-alpha2
  • S6K-alpha-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59722
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006196-M01G
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA

Publications for RSK3 Antibody (H00006196-M01G) (0)

There are no publications for RSK3 Antibody (H00006196-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSK3 Antibody (H00006196-M01G) (0)

There are no reviews for RSK3 Antibody (H00006196-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RSK3 Antibody (H00006196-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSK3 Products

Bioinformatics Tool for RSK3 Antibody (H00006196-M01G)

Discover related pathways, diseases and genes to RSK3 Antibody (H00006196-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSK3 Antibody (H00006196-M01G)

Discover more about diseases related to RSK3 Antibody (H00006196-M01G).
 

Pathways for RSK3 Antibody (H00006196-M01G)

View related products by pathway.

PTMs for RSK3 Antibody (H00006196-M01G)

Learn more about PTMs related to RSK3 Antibody (H00006196-M01G).
 

Research Areas for RSK3 Antibody (H00006196-M01G)

Find related products by research area.

Blogs on RSK3

There are no specific blogs for RSK3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSK3 Antibody (1F6) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KA2
Entrez