Recombinant Human RSBN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RSBN1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-411 of Human RSBN1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RSBN1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RSBN1 Protein

  • DKFZp781E21150
  • FLJ11220
  • ROSBIN
  • round spermatid basic protein 1
  • RP11-324J2.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010745-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RSBN1 Recombinant Protein (H00054665-P01) (0)

There are no publications for RSBN1 Recombinant Protein (H00054665-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSBN1 Recombinant Protein (H00054665-P01) (0)

There are no reviews for RSBN1 Recombinant Protein (H00054665-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RSBN1 Recombinant Protein (H00054665-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RSBN1 Products

RSBN1 H00054665-P01

Bioinformatics Tool for RSBN1 Recombinant Protein (H00054665-P01)

Discover related pathways, diseases and genes to RSBN1 Recombinant Protein (H00054665-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSBN1 Recombinant Protein (H00054665-P01)

Discover more about diseases related to RSBN1 Recombinant Protein (H00054665-P01).

Blogs on RSBN1

There are no specific blogs for RSBN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RSBN1 Antibody
NBP1-83765

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RSBN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RSBN1