RRP4 Antibody

Images

 
Western Blot: RRP4 Antibody [NBP1-70698] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry: RRP4 Antibody [NBP1-70698] - Human Lung cell Cellular data: alveolar cell of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Product Details

Summary
Product Discontinued
View other related RRP4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-70698
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RRP4 Antibody Summary

Immunogen
Synthetic peptides corresponding to EXOSC2 (exosome component 2) The peptide sequence was selected from the N terminal of EXOSC2. Peptide sequence RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV.
Clonality
Polyclonal
Host
Rabbit
Gene
EXOSC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against EXOSC2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RRP4 Antibody

  • exosome component 2Ribosomal RNA-processing protein 4
  • homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease(RRP4)
  • homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease
  • hRrp4p
  • p7
  • RRP4exosome complex exonuclease RRP4
  • Rrp4p

Background

EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for RRP4 Antibody (NBP1-70698) (0)

There are no publications for RRP4 Antibody (NBP1-70698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRP4 Antibody (NBP1-70698) (0)

There are no reviews for RRP4 Antibody (NBP1-70698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RRP4 Antibody (NBP1-70698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RRP4 Products

Bioinformatics Tool for RRP4 Antibody (NBP1-70698)

Discover related pathways, diseases and genes to RRP4 Antibody (NBP1-70698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RRP4

There are no specific blogs for RRP4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOSC2