RPS7 Antibody (3G4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RPS7 Primary Antibodies

Order Details


    • Catalog Number
      H00006201-M03G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPS7 Antibody (3G4) [DyLight 488] Summary

Immunogen
RPS7 (NP_001002, 95 a.a. - 194 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Specificity
RPS7 - ribosomal protein S7
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS7 Antibody (3G4) [DyLight 488]

  • DBA8,40S ribosomal protein S7
  • ribosomal protein S7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-57365
Species: Hu
Applications: WB

Publications for RPS7 Antibody (H00006201-M03G) (0)

There are no publications for RPS7 Antibody (H00006201-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS7 Antibody (H00006201-M03G) (0)

There are no reviews for RPS7 Antibody (H00006201-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS7 Antibody (H00006201-M03G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS7 Products

Bioinformatics Tool for RPS7 Antibody (H00006201-M03G)

Discover related pathways, diseases and genes to RPS7 Antibody (H00006201-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS7 Antibody (H00006201-M03G)

Discover more about diseases related to RPS7 Antibody (H00006201-M03G).
 

Pathways for RPS7 Antibody (H00006201-M03G)

View related products by pathway.

PTMs for RPS7 Antibody (H00006201-M03G)

Learn more about PTMs related to RPS7 Antibody (H00006201-M03G).

Blogs on RPS7

There are no specific blogs for RPS7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS7 Antibody (3G4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS7