RPS3A Antibody


Western Blot: RPS3A Antibody [NBP1-54688] - Total protein extract, Antibody Titration: 0.2-1 ug/ml
Western Blot: RPS3A Antibody [NBP1-54688] - Arabidopsis thaliana extract (30ug) Primary Diltution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:15,000 Exposure Time: 1 minute

Product Details

Product Discontinued
View other related RPS3A Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPS3A Antibody Summary

Synthetic peptides corresponding to RPS3A(ribosomal protein S3A) The peptide sequence was selected from the N terminal of RPS3A. Peptide sequence APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPS3A and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPS3A Antibody

  • 40S ribosomal protein S3a
  • FTE1
  • fte-1
  • MFTL
  • MGC23240
  • ribosomal protein S3A
  • v-fos transformation effector protein 1
  • v-fos transformation effector protein


RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for RPS3A Antibody (NBP1-54688) (0)

There are no publications for RPS3A Antibody (NBP1-54688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS3A Antibody (NBP1-54688) (0)

There are no reviews for RPS3A Antibody (NBP1-54688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS3A Antibody (NBP1-54688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RPS3A Antibody (NBP1-54688)

Discover related pathways, diseases and genes to RPS3A Antibody (NBP1-54688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS3A Antibody (NBP1-54688)

Discover more about diseases related to RPS3A Antibody (NBP1-54688).

Pathways for RPS3A Antibody (NBP1-54688)

View related products by pathway.

PTMs for RPS3A Antibody (NBP1-54688)

Learn more about PTMs related to RPS3A Antibody (NBP1-54688).

Blogs on RPS3A

There are no specific blogs for RPS3A, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPS3A Antibody and receive a gift card or discount.


Gene Symbol RPS3A