RPS2 Antibody (3G6) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related RPS2 Primary Antibodies

Order Details


    • Catalog Number
      H00006187-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPS2 Antibody (3G6) [PE] Summary

Immunogen
RPS2 (NP_002943 198 a.a. - 293 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Localization
Cytoplasmic ribosomal
Specificity
RPS2 - ribosomal protein S2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS2 Antibody (3G6) [PE]

  • LLREP3
  • MGC102851
  • MGC117344
  • MGC117345,40S ribosomal protein S4
  • OK/KNS-cl.6,40S ribosomal protein S2
  • Protein LLRep3
  • ribosomal protein S2
  • RPS4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP1-83205
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-58885
Species: Hu
Applications: WB, ICC/IF
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for RPS2 Antibody (H00006187-M01PE) (0)

There are no publications for RPS2 Antibody (H00006187-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS2 Antibody (H00006187-M01PE) (0)

There are no reviews for RPS2 Antibody (H00006187-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS2 Antibody (H00006187-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS2 Products

Bioinformatics Tool for RPS2 Antibody (H00006187-M01PE)

Discover related pathways, diseases and genes to RPS2 Antibody (H00006187-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS2 Antibody (H00006187-M01PE)

Discover more about diseases related to RPS2 Antibody (H00006187-M01PE).
 

Pathways for RPS2 Antibody (H00006187-M01PE)

View related products by pathway.

PTMs for RPS2 Antibody (H00006187-M01PE)

Learn more about PTMs related to RPS2 Antibody (H00006187-M01PE).

Blogs on RPS2

There are no specific blogs for RPS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS2 Antibody (3G6) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS2