RPP21 Antibody

Images

 
Immunohistochemistry: RPP21 Antibody [NBP2-31890] - Staining of cerebellum.
Immunohistochemistry: RPP21 Antibody [NBP2-31890] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: RPP21 Antibody [NBP2-31890] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: RPP21 Antibody [NBP2-31890] - Staining of pancreatic cancer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPP21 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPP21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPP21 Antibody

  • C6orf135
  • CAT60
  • chromosome 6 open reading frame 135
  • EC 3.1.26.5
  • Em:AB014085.3
  • FLJ22638
  • ribonuclease P 21kDa subunit
  • ribonuclease P protein subunit p21
  • Ribonuclease P/MRP 21 kDa subunit
  • ribonuclease P/MRP 21kDa subunit
  • Ribonucleoprotein V
  • RNaseP protein p21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13789
Species: Hu
Applications: IHC, IHC-P
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010557-R03
Species: Hu
NBP1-26606
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP, ICC
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2635
Species: Hu
Applications: WB
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE

Publications for RPP21 Antibody (NBP2-31890) (0)

There are no publications for RPP21 Antibody (NBP2-31890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP21 Antibody (NBP2-31890) (0)

There are no reviews for RPP21 Antibody (NBP2-31890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RPP21 Antibody (NBP2-31890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPP21 Products

Bioinformatics Tool for RPP21 Antibody (NBP2-31890)

Discover related pathways, diseases and genes to RPP21 Antibody (NBP2-31890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP21 Antibody (NBP2-31890)

Discover more about diseases related to RPP21 Antibody (NBP2-31890).
 

Pathways for RPP21 Antibody (NBP2-31890)

View related products by pathway.

PTMs for RPP21 Antibody (NBP2-31890)

Learn more about PTMs related to RPP21 Antibody (NBP2-31890).

Blogs on RPP21

There are no specific blogs for RPP21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP21
Uniprot