RPP21 Antibody


Immunohistochemistry: RPP21 Antibody [NBP2-31875] - Staining of human skeletal muscle shows moderate cytoplasmic and nuclear positivity in myocytes.
Immunohistochemistry: RPP21 Antibody [NBP2-31875] - Staining of human skeletal muscle shows moderate cytoplasmic and nuclear positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC

Order Details

RPP21 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: YQAAHCVLAQDPENQALARFYCYTERTIAKRLVL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RPP21 Antibody

  • C6orf135
  • CAT60
  • chromosome 6 open reading frame 135
  • EC
  • Em:AB014085.3
  • FLJ22638
  • ribonuclease P 21kDa subunit
  • ribonuclease P protein subunit p21
  • Ribonuclease P/MRP 21 kDa subunit
  • ribonuclease P/MRP 21kDa subunit
  • Ribonucleoprotein V
  • RNaseP protein p21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE

Publications for RPP21 Antibody (NBP2-31875) (0)

There are no publications for RPP21 Antibody (NBP2-31875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP21 Antibody (NBP2-31875) (0)

There are no reviews for RPP21 Antibody (NBP2-31875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RPP21 Antibody (NBP2-31875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RPP21 Products

Bioinformatics Tool for RPP21 Antibody (NBP2-31875)

Discover related pathways, diseases and genes to RPP21 Antibody (NBP2-31875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP21 Antibody (NBP2-31875)

Discover more about diseases related to RPP21 Antibody (NBP2-31875).

Pathways for RPP21 Antibody (NBP2-31875)

View related products by pathway.

PTMs for RPP21 Antibody (NBP2-31875)

Learn more about PTMs related to RPP21 Antibody (NBP2-31875).

Blogs on RPP21

There are no specific blogs for RPP21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPP21 Antibody and receive a gift card or discount.


Gene Symbol RPP21