RPL4 Antibody (4A3) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related RPL4 Primary Antibodies

Order Details


    • Catalog Number
      H00006124-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPL4 Antibody (4A3) [DyLight 488] Summary

Immunogen
RPL4 (NP_000959, 251 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
Specificity
RPL4 - ribosomal protein L4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL4 Antibody (4A3) [DyLight 488]

  • ribosomal protein L4,60S ribosomal protein L1,60S ribosomal protein L4
  • RPL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
CD6
627-CD
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00006124-M01G
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for RPL4 Antibody (H00006124-M01G) (0)

There are no publications for RPL4 Antibody (H00006124-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL4 Antibody (H00006124-M01G) (0)

There are no reviews for RPL4 Antibody (H00006124-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL4 Antibody (H00006124-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL4 Antibody (4A3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL4