RPL3 Antibody

Images

 
Western Blot: RPL3 Antibody [NBP1-57235] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related RPL3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57235
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPL3 Antibody Summary

Immunogen
Synthetic peptides corresponding to RPL3(ribosomal protein L3) The peptide sequence was selected from the C terminal of RPL3. Peptide sequence YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RPL3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL3 Antibody

  • 60S ribosomal protein L3
  • HIV-1 TAR RNA-binding protein B
  • MGC104284
  • ribosomal protein L3
  • TARBP-B

Background

Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. This gene is co-transcribed with several small nucleolar RNA genes, which are located in several of this gene's introns. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CD6
627-CD
Species: Hu
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-61727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP1-57235
Species: Hu
Applications: WB

Publications for RPL3 Antibody (NBP1-57235) (0)

There are no publications for RPL3 Antibody (NBP1-57235).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL3 Antibody (NBP1-57235) (0)

There are no reviews for RPL3 Antibody (NBP1-57235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL3 Antibody (NBP1-57235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL3 Products

Bioinformatics Tool for RPL3 Antibody (NBP1-57235)

Discover related pathways, diseases and genes to RPL3 Antibody (NBP1-57235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL3 Antibody (NBP1-57235)

Discover more about diseases related to RPL3 Antibody (NBP1-57235).
 

Pathways for RPL3 Antibody (NBP1-57235)

View related products by pathway.

PTMs for RPL3 Antibody (NBP1-57235)

Learn more about PTMs related to RPL3 Antibody (NBP1-57235).

Blogs on RPL3

There are no specific blogs for RPL3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL3
Uniprot
COVID-19 update