RPL21 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPL21 Antibody [NBP2-13252] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli fibrillar center, cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPL21 Antibody [NBP2-13252] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Specificity
Specificity of human RPL21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPL21 Protein (NBP2-13252PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL21 Antibody

  • DKFZp686C06101
  • FLJ27458
  • L21,60S ribosomal protein L21
  • MGC104274
  • MGC104275
  • MGC71252
  • ribosomal protein L21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94240
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
H00006159-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-88163
Species: Hu
Applications: WB
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
H00058516-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20687
Species: Hu
Applications: WB, ICC/IF
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-97838
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-93788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06069
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13252
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RPL21 Antibody (NBP2-13252) (0)

There are no publications for RPL21 Antibody (NBP2-13252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL21 Antibody (NBP2-13252) (0)

There are no reviews for RPL21 Antibody (NBP2-13252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL21 Antibody (NBP2-13252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL21 Products

Array NBP2-13252

Bioinformatics Tool for RPL21 Antibody (NBP2-13252)

Discover related pathways, diseases and genes to RPL21 Antibody (NBP2-13252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL21 Antibody (NBP2-13252)

Discover more about diseases related to RPL21 Antibody (NBP2-13252).
 

Pathways for RPL21 Antibody (NBP2-13252)

View related products by pathway.

Blogs on RPL21

There are no specific blogs for RPL21, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL21