RPL15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPL15 Antibody [NBP1-84018] - Staining of human cell line U-2 OS shows positivity in nuclei.
Immunohistochemistry-Paraffin: RPL15 Antibody [NBP1-84018] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Product Discontinued
View other related RPL15 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-84018
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPL15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL15 Antibody

  • 60S ribosomal protein L15
  • EC45MGC88603
  • FLJ26304
  • ribosomal protein L15
  • RPL10
  • RPLY10
  • RPYL10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP2-20687
Species: Hu
Applications: WB, ICC/IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006159-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84018
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RPL15 Antibody (NBP1-84018) (0)

There are no publications for RPL15 Antibody (NBP1-84018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL15 Antibody (NBP1-84018) (0)

There are no reviews for RPL15 Antibody (NBP1-84018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL15 Antibody (NBP1-84018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL15 Products

Bioinformatics Tool for RPL15 Antibody (NBP1-84018)

Discover related pathways, diseases and genes to RPL15 Antibody (NBP1-84018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL15 Antibody (NBP1-84018)

Discover more about diseases related to RPL15 Antibody (NBP1-84018).
 

Pathways for RPL15 Antibody (NBP1-84018)

View related products by pathway.

PTMs for RPL15 Antibody (NBP1-84018)

Learn more about PTMs related to RPL15 Antibody (NBP1-84018).

Blogs on RPL15

There are no specific blogs for RPL15, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL15
COVID-19 update