RPL13 Antibody (3F6) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related RPL13 Primary Antibodies

Order Details


    • Catalog Number
      H00006137-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

RPL13 Antibody (3F6) [PerCP] Summary

Immunogen
RPL13 (NP_000968 112 a.a. - 211 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK
Specificity
RPL13 - ribosomal protein L13
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPL13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPL13 Antibody (3F6) [PerCP]

  • BBC1FLJ27454
  • Breast basic conserved protein 1
  • D16S444E
  • FLJ27453
  • MGC117342
  • MGC71373,60S ribosomal protein L13
  • OK/SW-cl.46
  • ribosomal protein L13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu

Publications for RPL13 Antibody (H00006137-M01PCP) (0)

There are no publications for RPL13 Antibody (H00006137-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL13 Antibody (H00006137-M01PCP) (0)

There are no reviews for RPL13 Antibody (H00006137-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL13 Antibody (H00006137-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL13 Products

Bioinformatics Tool for RPL13 Antibody (H00006137-M01PCP)

Discover related pathways, diseases and genes to RPL13 Antibody (H00006137-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL13 Antibody (H00006137-M01PCP)

Discover more about diseases related to RPL13 Antibody (H00006137-M01PCP).
 

Pathways for RPL13 Antibody (H00006137-M01PCP)

View related products by pathway.

Research Areas for RPL13 Antibody (H00006137-M01PCP)

Find related products by research area.

Blogs on RPL13

There are no specific blogs for RPL13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL13 Antibody (3F6) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL13