ROR2 Antibody (1F7)

Images

 
Sandwich ELISA: ROR2 Antibody (1F7) [H00004920-M02] - Detection limit for recombinant GST tagged ROR2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ROR2 Antibody (1F7) Summary

Immunogen
ROR2 (NP_004551, 34 a.a. - 143 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
Specificity
ROR2 (1F7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ROR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ROR2 Antibody (1F7)

  • BDB
  • BDB1
  • EC 2.7.10.1
  • MGC163394
  • neurotrophic tyrosine kinase receptor-related 2
  • Neurotrophic tyrosine kinase, receptor-related 2
  • NTRKR2
  • NTRKR2tyrosine-protein kinase transmembrane receptor ROR2
  • receptor tyrosine kinase-like orphan receptor 2
  • ROR2

Background

The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

645-WN/CF
Species: Hu, Mu
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4649
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
AF853
Species: Mu
Applications: WB, IHC
AF1120
Species: Mu
Applications: WB, IHC
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1617
Species: Hu
Applications: WB
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF198
Species: Mu
Applications: WB, IHC
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-46367
Species: Hu
Applications: WB, IHC
H00004920-M02
Species: Hu
Applications: ELISA

Publications for ROR2 Antibody (H00004920-M02) (0)

There are no publications for ROR2 Antibody (H00004920-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR2 Antibody (H00004920-M02) (0)

There are no reviews for ROR2 Antibody (H00004920-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ROR2 Antibody (H00004920-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROR2 Products

Bioinformatics Tool for ROR2 Antibody (H00004920-M02)

Discover related pathways, diseases and genes to ROR2 Antibody (H00004920-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR2 Antibody (H00004920-M02)

Discover more about diseases related to ROR2 Antibody (H00004920-M02).
 

Pathways for ROR2 Antibody (H00004920-M02)

View related products by pathway.

PTMs for ROR2 Antibody (H00004920-M02)

Learn more about PTMs related to ROR2 Antibody (H00004920-M02).
 

Research Areas for ROR2 Antibody (H00004920-M02)

Find related products by research area.

Blogs on ROR2

There are no specific blogs for ROR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROR2 Antibody (1F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ROR2
Entrez
OMIM
Uniprot