ROR gamma/RORC/NR1F3 Antibody


Western Blot: ROR gamma Antibody [NBP1-53034] - HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related ROR gamma/RORC/NR1F3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ROR gamma/RORC/NR1F3 Antibody Summary

Synthetic peptides corresponding to RORC(RAR-related orphan receptor C) The peptide sequence was selected from the N terminal of RORC. Peptide sequence EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RORC and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ROR gamma/RORC/NR1F3 Antibody

  • MGC129539
  • NR1F3
  • Nuclear receptor ROR gamma
  • Nuclear receptor ROR-gamma
  • Nuclear receptor RZR gamma
  • Nuclear receptor RZR-gamma
  • Nuclear receptor subfamily 1 group F member 3
  • RAR-Related Orphan Nuclear Receptor Variant 2
  • RAR-related orphan receptor C
  • RAR-related orphan receptor gamma
  • retinoic acid-binding receptor gamma
  • retinoid-related orphan receptor gamma
  • Retinoid-related orphan receptor-gamma
  • ROR gamma
  • RORC
  • RORG
  • RORGMGC129539
  • RZRG
  • TOR


RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC-Fr
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034) (0)

There are no publications for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034) (0)

There are no reviews for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034). (Showing 1 - 2 of 2 FAQ).

  1. Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?
    • Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.
  2. What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?
    • The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Secondary Antibodies


Isotype Controls

Additional ROR gamma/RORC/NR1F3 Products

Bioinformatics Tool for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034)

Discover related pathways, diseases and genes to ROR gamma/RORC/NR1F3 Antibody (NBP1-53034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034)

Discover more about diseases related to ROR gamma/RORC/NR1F3 Antibody (NBP1-53034).

Pathways for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034)

View related products by pathway.

PTMs for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034)

Learn more about PTMs related to ROR gamma/RORC/NR1F3 Antibody (NBP1-53034).

Research Areas for ROR gamma/RORC/NR1F3 Antibody (NBP1-53034)

Find related products by research area.

Blogs on ROR gamma/RORC/NR1F3

There are no specific blogs for ROR gamma/RORC/NR1F3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ROR gamma/RORC/NR1F3 Antibody and receive a gift card or discount.


Gene Symbol RORC