ROR beta Antibody (1E5.)

Images

 
Western Blot: ROR beta Antibody (1E5) [H00006096-M08] - Analysis of RORB expression in transfected 293T cell line by RORB monoclonal antibody (M08), clone 1E5. Lane 1: RORB transfected lysate (Predicted MW: 52.1 KDa). ...read more
Sandwich ELISA: ROR beta Antibody (1E5) [H00006096-M08] - Detection limit for recombinant GST tagged RORB is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ROR beta Antibody (1E5.) Summary

Immunogen
RORB (NP_008845, 136 a.a. - 224 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL
Specificity
RORB (1E5)
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
RORB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ROR beta Antibody (1E5.)

  • NR1F2
  • NR1F2nuclear receptor ROR-beta
  • Nuclear receptor RZR-beta
  • Nuclear receptor subfamily 1 group F member 2
  • RAR-related orphan receptor B
  • RAR-related orphan receptor beta
  • retinoic acid-binding receptor beta
  • retinoid-related orphan receptor beta
  • Retinoid-related orphan receptor-beta
  • ROR beta
  • RORB
  • ROR-BETA
  • RZRB
  • RZRBbA133M9.1
  • RZR-BETA

Background

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBL1-10680
Species: Hu
NBP1-46119
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00338917-T01
Species: Hu
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-84934
Species: Hu
Applications: IHC, IHC-P
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
AF2945
Species: Hu
Applications: WB
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ROR beta Antibody (H00006096-M08) (0)

There are no publications for ROR beta Antibody (H00006096-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR beta Antibody (H00006096-M08) (0)

There are no reviews for ROR beta Antibody (H00006096-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROR beta Antibody (H00006096-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ROR beta Products

Bioinformatics Tool for ROR beta Antibody (H00006096-M08)

Discover related pathways, diseases and genes to ROR beta Antibody (H00006096-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ROR beta Antibody (H00006096-M08)

Discover more about diseases related to ROR beta Antibody (H00006096-M08).
 

Pathways for ROR beta Antibody (H00006096-M08)

View related products by pathway.

PTMs for ROR beta Antibody (H00006096-M08)

Learn more about PTMs related to ROR beta Antibody (H00006096-M08).
 

Research Areas for ROR beta Antibody (H00006096-M08)

Find related products by research area.

Blogs on ROR beta

There are no specific blogs for ROR beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ROR beta Antibody (1E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RORB
Entrez
OMIM
Uniprot